Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.47
PubTator Score 2.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
glioblastoma -1.600 0.000
osteosarcoma -1.082 0.020
ependymoma -1.200 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
tuberculosis and treatment for 6 months 1.400 0.000
pediatric high grade glioma -1.200 0.001
pilocytic astrocytoma -1.300 0.000
subependymal giant cell astrocytoma -2.136 0.017
pituitary cancer 1.200 0.000

Gene RIF (3)

PMID Text
19536175 Observational study of gene-disease association. (HuGE Navigator)
17613536 B4GALT3, DAP3, RGS16, TMEM183A and UCK2--were significantly overexpressed in dup(1q)-positive ALLs compared with high hyperdiploid ALLs without dup(1q).
16644869 c1orf37-dup encodes a novel transmembrane protein in humans which potentially endows new properties to cell surface interactions

AA Sequence

MARGPGPLGRPRPDTVAMPKRGKRLKFRAHDACSGRVTVADYANSDPAVVRSGRVKKAVANAVQQEVKSL      1 - 70
CGLEASQVPAEEALSGAGEPCDIIDSSDEMDAQEESIHERTVSRKKKSKRHKEELDGAGGEEYPMDIWLL     71 - 140
LASYIRPEDIVNFSLICKNAWTVTCTAAFWTRLYRRHYTLDASLPLRLRPESMEKLRCLRACVIRSLYHM    141 - 210
YEPFAARISKNPAIPESTPSTLKNSKCLLFWCRKIVGNRQEPMWEFNFKFKKQSPRLKSKCTGGLQPPVQ    211 - 280
YEDVHTNPDQDCCLLQVTTLNFIFIPIVMGMIFTLFTINVSTDMRHHRVRLVFQDSPVHGGRKLRSEQGV    281 - 350
QVILDPVHSVRLFDWWHPQYPFSLRA                                                351 - 376
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
17613536 2007 Tiling resolution array comparative genomic hybridization, expression and methylation analyses of dup(1q) in Burkitt lymphomas and pediatric high hyperdiploid acute lymphoblastic leukemias reveal clustered near-centromeric breakpoints and overexpression of genes in 1q22-32.3.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16644869 2006 Origination and evolution of a human-specific transmembrane protein gene, c1orf37-dup.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.