Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.47
PubTator Score 2.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.200 1.1e-02
Astrocytoma, Pilocytic -1.300 1.4e-04
atypical teratoid / rhabdoid tumor -1.800 4.7e-06
ependymoma -1.200 3.1e-06
glioblastoma -1.600 3.5e-06
osteosarcoma -1.082 2.0e-02
pituitary cancer 1.200 3.7e-05
subependymal giant cell astrocytoma -2.136 1.7e-02
tuberculosis and treatment for 6 months 1.400 1.7e-05

Gene RIF (3)

AA Sequence

MARGPGPLGRPRPDTVAMPKRGKRLKFRAHDACSGRVTVADYANSDPAVVRSGRVKKAVANAVQQEVKSL      1 - 70
CGLEASQVPAEEALSGAGEPCDIIDSSDEMDAQEESIHERTVSRKKKSKRHKEELDGAGGEEYPMDIWLL     71 - 140
LASYIRPEDIVNFSLICKNAWTVTCTAAFWTRLYRRHYTLDASLPLRLRPESMEKLRCLRACVIRSLYHM    141 - 210
YEPFAARISKNPAIPESTPSTLKNSKCLLFWCRKIVGNRQEPMWEFNFKFKKQSPRLKSKCTGGLQPPVQ    211 - 280
YEDVHTNPDQDCCLLQVTTLNFIFIPIVMGMIFTLFTINVSTDMRHHRVRLVFQDSPVHGGRKLRSEQGV    281 - 350
QVILDPVHSVRLFDWWHPQYPFSLRA                                                351 - 376
//

Text Mined References (10)

PMID Year Title