Property Summary

NCBI Gene PubMed Count 12
PubMed Score 15.15
PubTator Score 10.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
malignant mesothelioma 3232 1.0e-05
tuberculosis and treatment for 3 months 179 2.2e-04
osteosarcoma 7950 3.5e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Acute pancreatitis 10 3.543 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -1.100 1.0e-05
osteosarcoma 1.314 3.5e-04
tuberculosis and treatment for 3 months -1.200 2.2e-04

Protein-protein Interaction (1)

Gene RIF (2)

AA Sequence

MADFAGPSSAGRKAGAPRCSRKAAGTKQTSTLKQEDASKRKAELEAAVRKKIEFERKALHIVEQLLEENI      1 - 70
TEEFLMECGRFITPAHYSDVVDERSIVKLCGYPLCQKKLGIVPKQKYKISTKTNKVYDITERKSFCSNFC     71 - 140
YQASKFFEAQIPKTPVWVREEERHPDFQLLKEEQSGHSGEEVQLCSKAIKTSDIDNPSHFEKQYESSSSS    141 - 210
THSDSSSDNEQDFVSSILPGNRPNSTNIRPQLHQKSIMKKKAGHKANSKHKDKEQTVVDVTEQLGDCKLD    211 - 280
SQEKDATCELPLQKVNTQSSSNSTLPERLKASENSESEYSRSEITLVGISKKSAEHFKRKFAKSNQVSRS    281 - 350
VSSSVQVCPEVGKRNLLKVLKETLIEWKTEETLRFLYGQNYASVCLKPEASLVKEELDEDDIISDPDSHF    351 - 420
PAWRESQNSLDESLPFRGSGTAIKPLPSYENLKKETEKLNLRIREFYRGRYVLGEETTKSQDSEEHDSTF    421 - 490
PLIDSSSQNQIRKRIVLEKLSKVLPGLLVPLQITLGDIYTQLKNLVRTFRLTNRNIIHKPAEWTLIAMVL    491 - 560
LSLLTPILGIQKHSQEGMVFTRFLDTLLEELHLKNEDLESLTIIFRTSCLPE                      561 - 612
//

Text Mined References (16)

PMID Year Title