Property Summary

NCBI Gene PubMed Count 10
Grant Count 4
R01 Count 4
Funding $1,156,481
PubMed Score 14.05
PubTator Score 10.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
osteosarcoma 1.423 0.000
tuberculosis and treatment for 6 months -1.300 0.000

Synonym

Accession Q8IXW5 C9JKB5 Q49AS7 Q9H8Y2
Symbols Rtr1
C1orf82

Gene

Gene RIF (2)

PMID Text
25639305 These results suggest that RPAP2 controls Pol II activity through a direct interaction with Rpb6
22137580 During transcription of snRNA genes, Ser7 phosphorylation facilitates recruitment of RPAP2, which in turn both recruits Integrator and dephosphorylates Ser5.

AA Sequence

MADFAGPSSAGRKAGAPRCSRKAAGTKQTSTLKQEDASKRKAELEAAVRKKIEFERKALHIVEQLLEENI      1 - 70
TEEFLMECGRFITPAHYSDVVDERSIVKLCGYPLCQKKLGIVPKQKYKISTKTNKVYDITERKSFCSNFC     71 - 140
YQASKFFEAQIPKTPVWVREEERHPDFQLLKEEQSGHSGEEVQLCSKAIKTSDIDNPSHFEKQYESSSSS    141 - 210
THSDSSSDNEQDFVSSILPGNRPNSTNIRPQLHQKSIMKKKAGHKANSKHKDKEQTVVDVTEQLGDCKLD    211 - 280
SQEKDATCELPLQKVNTQSSSNSTLPERLKASENSESEYSRSEITLVGISKKSAEHFKRKFAKSNQVSRS    281 - 350
VSSSVQVCPEVGKRNLLKVLKETLIEWKTEETLRFLYGQNYASVCLKPEASLVKEELDEDDIISDPDSHF    351 - 420
PAWRESQNSLDESLPFRGSGTAIKPLPSYENLKKETEKLNLRIREFYRGRYVLGEETTKSQDSEEHDSTF    421 - 490
PLIDSSSQNQIRKRIVLEKLSKVLPGLLVPLQITLGDIYTQLKNLVRTFRLTNRNIIHKPAEWTLIAMVL    491 - 560
LSLLTPILGIQKHSQEGMVFTRFLDTLLEELHLKNEDLESLTIIFRTSCLPE                      561 - 612
//

Text Mined References (14)

PMID Year Title
25639305 2014 Human RNA polymerase II-associated protein 2 (RPAP2) interacts directly with the RNA polymerase II subunit Rpb6 and participates in pre-mRNA 3'-end formation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22781759 2012 The yeast regulator of transcription protein Rtr1 lacks an active site and phosphatase activity.
22231121 Control of the RNA polymerase II phosphorylation state in promoter regions by CTD interaction domain-containing proteins RPRD1A and RPRD1B.
22137580 2012 Ser7 phosphorylation of the CTD recruits the RPAP2 Ser5 phosphatase to snRNA genes.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17643375 2007 Systematic analysis of the protein interaction network for the human transcription machinery reveals the identity of the 7SK capping enzyme.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...