Property Summary

NCBI Gene PubMed Count 10
Grant Count 1
Funding $786,070.11
PubMed Score 4.63
PubTator Score 7.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.194 0.000
breast carcinoma -1.200 0.000
lung carcinoma 1.400 0.000
ductal carcinoma in situ -1.100 0.007
invasive ductal carcinoma -1.400 0.007
pituitary cancer 2.100 0.000

Gene RIF (3)

PMID Text
22988245 kelch protein KLHDC8B guards against mitotic errors, centrosomal amplification, and chromosomal instability
20107318 Deficiency of KLHDC8B leads to binucleated cells, implicating its involvement in Reed-Sternberg cell formation
19706467 Depletion of KLHDC8B through RNA interference leads to an increase in binucleated cells, implicating its reduced expression in the formation of classical Hodgkin lymphoma's signature Reed-Sternberg cell.

AA Sequence

MSAGGGRAFAWQVFPPMPTCRVYGTVAHQDGHLLVLGGCGRAGLPLDTAETLDMASHTWLALAPLPTARA      1 - 70
GAAAVVLGKQVLVVGGVDEVQSPVAAVEAFLMDEGRWERRATLPQAAMGVATVERDGMVYALGGMGPDTA     71 - 140
PQAQVRVYEPRRDCWLSLPSMPTPCYGASTFLHGNKIYVLGGRQGKLPVTAFEAFDLEARTWTRHPSLPS    141 - 210
RRAFAGCAMAEGSVFSLGGLQQPGPHNFYSRPHFVNTVEMFDLEHGSWTKLPRSLRMRDKRADFVVGSLG    211 - 280
GHIVAIGGLGNQPCPLGSVESFSLARRRWEALPAMPTARCSCSSLQAGPRLFVIGGVAQGPSQAVEALCL    281 - 350
RDGV                                                                      351 - 354
//

Text Mined References (10)

PMID Year Title
22988245 2012 The kelch protein KLHDC8B guards against mitotic errors, centrosomal amplification, and chromosomal instability.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
20107318 2010 Mutations in a gene encoding a midbody protein in binucleated Reed-Sternberg cells of Hodgkin lymphoma.
19706467 2009 Mutations in a gene encoding a midbody kelch protein in familial and sporadic classical Hodgkin lymphoma lead to binucleated cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8401585 1993 Rapid cDNA sequencing (expressed sequence tags) from a directionally cloned human infant brain cDNA library.