Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.63
PubTator Score 7.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Leg, Absence Deformity of, with Congenital Cataract 1 0.0 0.0
Disease Target Count
Hodgkin Disease 15
Disease Target Count P-value
lung carcinoma 2843 3.2e-18
pituitary cancer 1972 1.9e-09
breast carcinoma 1638 3.4e-04
osteosarcoma 7950 4.8e-04
invasive ductal carcinoma 2951 6.5e-03
ductal carcinoma in situ 1745 7.3e-03
Disease Target Count Z-score Confidence
Hodgkin's lymphoma 15 4.023 2.0
Disease Target Count
Lymphoma, Hodgkin, Classic 1

Expression

  Differential Expression (6)

Disease log2 FC p
breast carcinoma -1.200 3.4e-04
ductal carcinoma in situ -1.100 7.3e-03
invasive ductal carcinoma -1.400 6.5e-03
lung carcinoma 1.400 3.2e-18
osteosarcoma -1.194 4.8e-04
pituitary cancer 2.100 1.9e-09

Gene RIF (3)

AA Sequence

MSAGGGRAFAWQVFPPMPTCRVYGTVAHQDGHLLVLGGCGRAGLPLDTAETLDMASHTWLALAPLPTARA      1 - 70
GAAAVVLGKQVLVVGGVDEVQSPVAAVEAFLMDEGRWERRATLPQAAMGVATVERDGMVYALGGMGPDTA     71 - 140
PQAQVRVYEPRRDCWLSLPSMPTPCYGASTFLHGNKIYVLGGRQGKLPVTAFEAFDLEARTWTRHPSLPS    141 - 210
RRAFAGCAMAEGSVFSLGGLQQPGPHNFYSRPHFVNTVEMFDLEHGSWTKLPRSLRMRDKRADFVVGSLG    211 - 280
GHIVAIGGLGNQPCPLGSVESFSLARRRWEALPAMPTARCSCSSLQAGPRLFVIGGVAQGPSQAVEALCL    281 - 350
RDGV                                                                      351 - 354
//

Text Mined References (11)

PMID Year Title