Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.39
PubTator Score 5.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis -2.100 0.000
posterior fossa group A ependymoma 1.400 0.000
group 3 medulloblastoma 1.400 0.001
atypical teratoid / rhabdoid tumor 1.700 0.000
glioblastoma 1.100 0.002
medulloblastoma, large-cell 2.200 0.000
colon cancer 1.800 0.017
lung cancer -1.800 0.006
Breast cancer 2.100 0.036
lung adenocarcinoma 1.400 0.000
adult high grade glioma 1.200 0.000
non primary Sjogren syndrome sicca 1.100 0.022
non-small cell lung carcinoma 1.300 0.000

Gene RIF (2)

PMID Text
21874247 SLC35F2 was highly expressed in NSCLC tissues and the levels of expression, in particular the levels of the SLC35F2 transcript, were associated with NSCLC pathological staging.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWNILKTIALGQMLSLCICGTAITSQYLAERYKVN      1 - 70
TPMLQSFINYCLLFLIYTVMLAFRSGSDNLLVILKRKWWKYILLGLADVEANYVIVRAYQYTTLTSVQLL     71 - 140
DCFGIPVLMALSWFILHARYRVIHFIAVAVCLLGVGTMVGADILAGREDNSGSDVLIGDILVLLGASLYA    141 - 210
ISNVCEEYIVKKLSRQEFLGMVGLFGTIISGIQLLIVEYKDIASIHWDWKIALLFVAFALCMFCLYSFMP    211 - 280
LVIKVTSATSVNLGILTADLYSLFVGLFLFGYKFSGLYILSFTVIMVGFILYCSTPTRTAEPAESSVPPV    281 - 350
TSIGIDNLGLKLEENLQETHSAVL                                                  351 - 374
//

Text Mined References (13)

PMID Year Title
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21874247 Highly expressed SLC35F2 in non-small cell lung cancer is associated with pathological staging.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...