Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Weight Gain 87
Disease Target Count P-value
oligodendroglioma 2849 2.19324748725961E-17
atypical teratoid / rhabdoid tumor 4369 9.08186902050036E-11
ependymoma 2514 6.10953409650173E-10
juvenile dermatomyositis 1189 3.17736636123789E-9
glioblastoma 5572 9.29123966158785E-9
medulloblastoma 1524 2.05737925940076E-8
medulloblastoma, large-cell 6234 7.38535230010472E-7
osteosarcoma 7933 3.04219054959473E-6
pilocytic astrocytoma 3086 2.20643828526894E-5
primitive neuroectodermal tumor 3031 0.0017582914164638
adrenocortical carcinoma 1427 0.00427736497980884
adult high grade glioma 2148 0.00681565430815892
Pick disease 1893 0.00714723877520818
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0136753707877298
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0145870143630701
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0159177284356023
astrocytic glioma 2241 0.0183635299906711
aldosterone-producing adenoma 664 0.0442345221792257

Expression

Synonym

Accession Q8IXS8 B2RCG7 Q4ZG87 Q53TX6
Symbols HYCC2

Gene

  Ortholog (10)

AA Sequence

MLGTDRCVVEEWLSEFKALPDTQITSYAATLHRKKTLVPALYKVIQDSNNELLEPVCHQLFELYRSSEVR      1 - 70
LKRFTLQFLPELMWVYLRLTVSRDRQSNGCIEALLLGIYNLEIADKDGNNKVLSFTIPSLSKPSIYHEPS     71 - 140
TIGSMALTEGALCQHDLIRVVYSDLHPQRETFTAQNRFEVLSFLMLCYNSAIVYMPASSYQSLCRMGSRV    141 - 210
CVSGFPRQHEKHWKELCGRIVLDPEFMVQLLTGVYYAMYNGQWDLGQEVLDDIIYRAQLELFSQPLLVAN    211 - 280
AMKNSLPFDAPDSTQEGQKVLKVEVTPTVPRISRTAITTASIRRHRWRREGAEGVNGGEESVNLNDADEG    281 - 350
FSSGASLSSQPIGTKPSSSSQRGSLRKVATGRSAKDKETASAIKSSESPRDSVVRKQYVQQPTDLSVDSV    351 - 420
ELTPMKKHLSLPAGQVVPKINSLSLIRTASASSSKSFDYVNGSQASTSIGVGTEGGTNLAANNANRYSTV    421 - 490
SLQEDRLGQAGEGKELLSPGAPLTKQSRSPSFNMQLISQV                                  491 - 530
//

Text Mined References (12)

PMID Year Title
26571211 2016 The leukodystrophy protein FAM126A (hyccin) regulates PtdIns(4)P synthesis at the plasma membrane.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...