Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma 1.217 4.3e-03
adult high grade glioma -2.200 5.9e-04
aldosterone-producing adenoma -1.201 4.4e-02
astrocytic glioma -1.800 1.8e-02
Astrocytoma, Pilocytic -1.300 3.4e-03
atypical teratoid / rhabdoid tumor -1.700 2.8e-04
ependymoma -1.600 1.1e-02
glioblastoma -1.200 7.7e-04
intraductal papillary-mucinous adenoma (... 1.500 1.4e-02
intraductal papillary-mucinous carcinoma... 1.100 1.5e-02
intraductal papillary-mucinous neoplasm ... 1.400 2.9e-02
juvenile dermatomyositis 1.023 3.2e-09
medulloblastoma -1.500 1.0e-04
medulloblastoma, large-cell -2.000 4.2e-05
oligodendroglioma -1.500 2.2e-17
osteosarcoma 2.388 3.0e-06
Pick disease -1.100 7.1e-03
primitive neuroectodermal tumor -1.200 2.7e-03

Synonym

Accession Q8IXS8 B2RCG7 Q4ZG87 Q53TX6
Symbols HYCC2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MLGTDRCVVEEWLSEFKALPDTQITSYAATLHRKKTLVPALYKVIQDSNNELLEPVCHQLFELYRSSEVR      1 - 70
LKRFTLQFLPELMWVYLRLTVSRDRQSNGCIEALLLGIYNLEIADKDGNNKVLSFTIPSLSKPSIYHEPS     71 - 140
TIGSMALTEGALCQHDLIRVVYSDLHPQRETFTAQNRFEVLSFLMLCYNSAIVYMPASSYQSLCRMGSRV    141 - 210
CVSGFPRQHEKHWKELCGRIVLDPEFMVQLLTGVYYAMYNGQWDLGQEVLDDIIYRAQLELFSQPLLVAN    211 - 280
AMKNSLPFDAPDSTQEGQKVLKVEVTPTVPRISRTAITTASIRRHRWRREGAEGVNGGEESVNLNDADEG    281 - 350
FSSGASLSSQPIGTKPSSSSQRGSLRKVATGRSAKDKETASAIKSSESPRDSVVRKQYVQQPTDLSVDSV    351 - 420
ELTPMKKHLSLPAGQVVPKINSLSLIRTASASSSKSFDYVNGSQASTSIGVGTEGGTNLAANNANRYSTV    421 - 490
SLQEDRLGQAGEGKELLSPGAPLTKQSRSPSFNMQLISQV                                  491 - 530
//

Text Mined References (12)

PMID Year Title