Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 4.3e-05
ovarian cancer 8520 1.9e-04
intraductal papillary-mucinous adenoma (IPMA) 2955 7.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (3)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... -1.200 7.0e-03
osteosarcoma -1.010 4.3e-05
ovarian cancer -1.400 1.9e-04

Synonym

Accession Q8IXS0 Q5JYK1
Symbols C6orf146

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

 Compartment GO Term (1)

AA Sequence

MGRRNENCANSLRVSNISQENLSHWNLDSEVPVSENKNLPAGRDGAAGGKINKNYLEIPVEQLMLEPNLS      1 - 70
VHSQKSTQNSKQGIFQLWNCPLNEGSTIEKREFKKSSVETGFNVINHPIRVFTLNHPLTIASVDKQVGPY     71 - 140
PGLPMPLGLCWPYADGDFFKNRNEIHVSSCSTIENNDGETLPAPNWNLKHGNSSVEENFTDESDLSENEK    141 - 210
TNDTLLSYFKKVDLNLKPETIKNVEEPFTEEPNEVFPYPDFLPPPFSALDLHNLALSKSDNWKVTVDPAE    211 - 280
TSVEHLITRLLELERLQHMTIQKERPRLQTTFCTPAVTERPSSSKATPKVRQPKLCDSLSLQIPCVDKSQ    281 - 350
EKSKNNSGSCKLEQNALKRNWSNAGKYRWNSRPLSLKSSSTPKQLIETYDKNPKSSILSPCQELSFKPTI    351 - 420
GHTNQSMVKMVSTRCLPWRSPMPVSPIPLTFPENQKEEIKAPKRNFGTKKKLYRQNIVLNRPFSIQKLNC    421 - 490
LSPSLIAKDKCCSPIEQK                                                        491 - 508
//

Text Mined References (5)

PMID Year Title