Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 3.1e-36
non-small cell lung cancer 2890 8.6e-12
ovarian cancer 8520 1.0e-05
cystic fibrosis 1696 5.5e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
primary open angle glaucoma 16 3.172 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
cystic fibrosis 1.667 5.5e-05
non-small cell lung cancer 1.721 8.6e-12
ovarian cancer 1.600 1.0e-05
psoriasis 1.200 3.1e-36

Gene RIF (1)

AA Sequence

MASPLPSGFPARRNSRLDVFLRRHLPPEVYDAVRAYEPCIVVSNSENHILKYVVLSDRLVYLTENPPKSI      1 - 70
RRVVALRDVVAIDLIDDYPEFLSSPDREISQHIRIIYSSTVLKKECKKSNSVRKFLFPFHHTKANNKKVK     71 - 140
EEKNGLAFWRSKESRSLKESPLRDQQESSTPSKDSTLCPRPGLKKLSLHGQGAFRPLPSPSRRSSQSAPT    141 - 210
TGKAVSEPSCTTNTKEPQGLPDHNSISEIPFKCNGNGNEFYLGNSLLDSPSQSNSNLEKKESELHLYVIS    211 - 280
TTSSIFLHLKSSWNNYIIKATLLQDPFYASEFSPAIGSQKPYRSEEKIKHFSQLKSELFLKDNSLRRILS    281 - 350
LLMELKVAAQKNFILKRLFWKTSDLFYFIVNKLHEYLPESRDKNALQNQSQRVDELVACIEIIQTLVLMF    351 - 420
RETETESSRLNTLAAKKGALFNLLVILISEPQIPKSCPVFDIQLVADSALVRMSFDAELQKLILEYTNTA    421 - 490
TALLYEILLVFQQGNLGLGSTKFAISWIMSFLQSCPPIITFVASIVKQVVRGLSASFQLLSPCQAVLLYQ    491 - 560
QFYILKSCLRHSRTLAEYIRNNYREEFRYFIHMPALQKRLPLCYPITQPTIQLFHEVLKLVE            561 - 622
//

Text Mined References (5)

PMID Year Title