Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 5.7e-10
osteosarcoma 7950 2.1e-05

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.659 2.1e-05
ovarian cancer 1.100 5.7e-10

Gene RIF (1)

AA Sequence

MAHEREILKGMYEELKEKSHKPDVELIQHRAWRIDMVSTELESFRKASYIESGPEEFYQRFKKCFSATHI      1 - 70
FISIKGKDSQNTAHGYLILNRTLHQQLKIKNPFLAPSSEAVRIPATLPHPGALPFPPYVAKASSDELLNL     71 - 140
QKPLQSALGFVILRSSQNWNSKNRQRWSRTKAGQMSHGLQMAGPQETVLALPLREGVQAAATVPILLYNL    141 - 210
EDGLSDHPLDQGPRCPARRPCSPASAPAPTSPKKPKIQAPGETFPTDWSPPPVEFLNPRVLQASREAPAQ    211 - 280
RWVGVVGPQGLRRLAGELPEELEQEHLDLDPKRGLALPEKLFWNTSGLSQQAAAPEFSWGGSGSYFNNLD    281 - 350
YLLQEKREQALEQERERLLLQECLNLNSLDLDEEEVPLTPEHRMLVEKYSVSLQTIPPVHPGETVFLPRC    351 - 420
HPLPCILDSSLLKPRSHLEGLFLSSPPAQQLSFLRSGLLNILYLHMPDCPVSLLQWLFQLLTWPPETSLG    421 - 490
AFGLLWDLIVDGIFLQPDEDKHLWCPSLQEVREAFHSLGAHSPALYPLGPFWHGGRVLPGEAGLNENEEQ    491 - 560
DAPQEIALDISLGHIYKFLALCAQAQPGAYTDENLMGLIELLCRTSLDVGLRLLPKVDLQQLLLLLLENI    561 - 630
REWPGKLQELCCTLSWVSDHHHNLLALVQFFPDMTSRSRRLRSQLSLVVIARMLGQQEMLPLWQEKTQLS    631 - 700
SLSRLLGLMRPSSLRQYLDSVPLPPCQEQQPKASAELDHKACYLCHSLLMLAGVVVSCQDITPDQWGELQ    701 - 770
LLCMQLDRHISTQIRESPQAMHRTMLKDLATQTYIRWQELLTHCQPQAQYFSPWKDI                 771 - 827
//

Text Mined References (5)

PMID Year Title