Property Summary

NCBI Gene PubMed Count 17
PubMed Score 9.61
PubTator Score 9.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adrenocortical carcinoma 1.047 1.9e-02
adult high grade glioma 1.600 2.3e-04
Astrocytoma, Pilocytic 1.400 1.2e-04
atypical teratoid / rhabdoid tumor 1.600 1.3e-04
ependymoma 1.200 8.8e-06
glioblastoma 1.800 1.7e-05
group 3 medulloblastoma 1.600 7.9e-04
intraductal papillary-mucinous neoplasm ... 1.500 1.2e-02
lung cancer 1.800 2.2e-03
malignant mesothelioma 1.100 1.0e-05
medulloblastoma, large-cell 1.900 1.6e-06
Multiple myeloma 1.034 4.7e-02
non-small cell lung cancer 1.322 5.1e-14
ovarian cancer -2.000 4.4e-06
primitive neuroectodermal tumor 2.100 9.1e-05
psoriasis -1.600 2.8e-04

 GO Process (1)

Gene RIF (8)

AA Sequence

MAASGVEKSSKKKTEKKLAAREEAKLLAGFMGVMNNMRKQKTLCDVILMVQERKIPAHRVVLAAASHFFN      1 - 70
LMFTTNMLESKSFEVELKDAEPDIIEQLVEFAYTARISVNSNNVQSLLDAANQYQIEPVKKMCVDFLKEQ     71 - 140
VDASNCLGISVLAECLDCPELKATADDFIHQHFTEVYKTDEFLQLDVKRVTHLLNQDTLTVRAEDQVYDA    141 - 210
AVRWLKYDEPNRQPFMVDILAKVRFPLISKNFLSKTVQAEPLIQDNPECLKMVISGMRYHLLSPEDREEL    211 - 280
VDGTRPRRKKHDYRIALFGGSQPQSCRYFNPKDYSWTDIRCPFEKRRDAACVFWDNVVYILGGSQLFPIK    281 - 350
RMDCYNVVKDSWYSKLGPPTPRDSLAACAAEGKIYTSGGSEVGNSALYLFECYDTRTESWHTKPSMLTQR    351 - 420
CSHGMVEANGLIYVCGGSLGNNVSGRVLNSCEVYDPATETWTELCPMIEARKNHGLVFVKDKIFAVGGQN    421 - 490
GLGGLDNVEYYDIKLNEWKMVSPMPWKGVTVKCAAVGSIVYVLAGFQGVGRLGHILEYNTETDKWVANSK    491 - 560
VRAFPVTSCLICVVDTCGANEETLET                                                561 - 586
//

Text Mined References (18)

PMID Year Title