Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.300 1.8e-03
atypical teratoid / rhabdoid tumor -1.200 4.1e-03
gastric cancer 1.200 1.2e-02
glioblastoma -1.400 1.9e-04
intraductal papillary-mucinous adenoma (... 1.100 6.6e-03
medulloblastoma, large-cell -1.200 4.0e-04
osteosarcoma -1.691 1.0e-04
ovarian cancer -1.500 1.4e-04
Pick disease -1.200 4.0e-03

AA Sequence

MARDLIGPALPPGFKARGTAEDEERDPSPVAGPALPPNYKSSSSDSSDSDEDSSSLYEEGNQESEEDDSG      1 - 70
PTARKQRKNQDDDDDDDDGFFGPALPPGFKKQDDSPPRPIIGPALPPGFIKSTQKSDKGRDDPGQQETDS     71 - 140
SEDEDIIGPMPAKGPVNYNVTTEFEKRAQRMKEKLTKGDDDSSKPIVRESWMTELPPEMKDFGLGPRTFK    141 - 210
RRADDTSGDRSIWTDTPADRERKAKETQEARKSSSKKDEEHILSGRDKRLAEQVSSYNESKRSESLMDIH    211 - 280
HKKLKSKAAEDKNKPQERIPFDRDKDLKVNRFDEAQKKALIKKSRELNTRFSHGKGNMFL              281 - 340
//

Text Mined References (13)

PMID Year Title