Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 8.59696634160173E-6
glioblastoma 5572 5.14327114423193E-5
ovarian cancer 8492 1.42890914936398E-4
pediatric high grade glioma 2712 2.71308081324385E-4
medulloblastoma, large-cell 6234 3.95667687894748E-4
atypical teratoid / rhabdoid tumor 4369 7.29807347625156E-4
Pick disease 1893 0.00401807886907034
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00663352506318448
gastric cancer 436 0.0122477356888653

Expression

  Differential Expression (9)

Disease log2 FC p
gastric cancer 1.200 0.012
osteosarcoma 1.966 0.000
atypical teratoid / rhabdoid tumor -1.500 0.001
glioblastoma -1.800 0.000
medulloblastoma, large-cell -1.200 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.007
pediatric high grade glioma -1.300 0.000
Pick disease -1.200 0.004
ovarian cancer -1.500 0.000

Synonym

Accession Q8IXQ4 A8K8X8 Q05BX8 Q05D87 Q5T3Z3 Q5T3Z5 Q9C0F9 Q9H2R0 Q9P0W6
Symbols LSR7
AD029
KIAA1704
bA245H20.2

Gene

PANTHER Protein Class (1)

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Xenopus OMA EggNOG
Zebrafish OMA EggNOG
C. elegans OMA EggNOG Inparanoid

AA Sequence

MARDLIGPALPPGFKARGTAEDEERDPSPVAGPALPPNYKSSSSDSSDSDEDSSSLYEEGNQESEEDDSG      1 - 70
PTARKQRKNQDDDDDDDDGFFGPALPPGFKKQDDSPPRPIIGPALPPGFIKSTQKSDKGRDDPGQQETDS     71 - 140
SEDEDIIGPMPAKGPVNYNVTTEFEKRAQRMKEKLTKGDDDSSKPIVRESWMTELPPEMKDFGLGPRTFK    141 - 210
RRADDTSGDRSIWTDTPADRERKAKETQEARKSSSKKDEEHILSGRDKRLAEQVSSYNESKRSESLMDIH    211 - 280
HKKLKSKAAEDKNKPQERIPFDRDKDLKVNRFDEAQKKALIKKSRELNTRFSHGKGNMFL              281 - 340
//

Text Mined References (12)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...