Outer dense fiber protein 3-like protein 1

Property Summary

NCBI Gene PubMed Count	2
PubMed Score	0.00

Knowledge Summary

Patent

No data available

TINX Plot

Disease (1)

Expression Atlas

Disease	Target Count	P-value
psoriasis	6694	1.4e-52
posterior fossa group B ependymoma	416	5.8e-04

Expression

Specificity
Differential

Differential Expression (2)

Disease	log2 FC	p
posterior fossa group B ependymoma	1.100	5.8e-04
psoriasis	-2.500	1.4e-52

Testis 18,518

Skin - Not Sun Exposed (Suprapubic) 18,081

Esophagus - Muscularis 18,017

Colon - Sigmoid 18,089

Esophagus - Gastroesophageal Junction 18,000

Skin - Sun Exposed (Lower leg) 17,968

Breast - Mammary Tissue 18,103

Pituitary 18,147

Adipose - Visceral (Omentum) 17,937

Adipose - Subcutaneous 18,110

Small Intestine - Terminal Ileum 17,954

Artery - Aorta 17,896

Artery - Coronary 17,949

Nerve - Tibial 18,007

Thyroid 18,024

Spleen 17,614

Artery - Tibial 17,631

Heart - Atrial Appendage 17,896

Stomach 17,879

Lung 18,057

Uterus 17,618

Vagina 17,834

Prostate 18,213

Brain - Hypothalamus 18,169

Colon - Transverse 17,825

Brain - Cerebellum 17,983

Brain - Cerebellar Hemisphere 18,015

Cells - Transformed fibroblasts 17,577

Esophagus - Mucosa 18,076

Brain - Cortex 18,039

Brain - Frontal Cortex (BA9) 18,069

Minor Salivary Gland 18,005

Ovary 17,971

Brain - Anterior cingulate cortex (BA24) 17,989

Brain - Substantia nigra 17,981

Brain - Amygdala 18,006

Brain - Spinal cord (cervical c-1) 17,973

Cells - EBV-transformed lymphocytes 18,186

Brain - Nucleus accumbens (basal ganglia... 18,024

Heart - Left Ventricle 18,006

Brain - Caudate (basal ganglia) 18,001

Brain - Hippocampus 18,011

Adrenal Gland 18,071

Kidney - Cortex 17,329

Brain - Putamen (basal ganglia) 17,863

Liver 18,071

Muscle - Skeletal 17,778

Pancreas 18,123

Whole Blood 17,439

B Cells 9,086

adipose tissue 15,837

adrenal gland 15,963

appendix 16,247

bone marrow 14,571

breast 16,063

cerebral cortex 16,630

cervix, uterine 15,871

colon 15,959

duodenum 15,975

endometrium 16,349

epididymis 15,863

esophagus 15,898

fallopian tube 16,245

gallbladder 16,333

heart muscle 14,972

kidney 15,917

liver 14,587

lung 16,312

lymph node 15,833

parathyroid gland 14,769

placenta 15,937

prostate 16,460

rectum 15,705

seminal vesicle 15,918

skin 16,206

small intestine 16,154

smooth muscle 15,857

spleen 15,972

stomach 16,099

testis 17,936

thyroid gland 15,959

tonsil 15,400

urinary bladder 15,814

Liver and Pancreas 16,750

Digestive Tract 17,369

Urinary Tract 16,678

Endocrine System 18,159

Blood and immune system 16,909

Respiratory system 16,393

Female tissues 17,400

Male tissues 17,142

Skin and soft tissues 17,230

Nervous System 16,725

Cardiovascular System 15,192

See source...

See source...

Synonym

Accession	Q8IXM7
Symbols

Gene

ODF3L1

PANTHER Protein Class (1)

structural protein 45

Ortholog (10)

Species	Source	Disease
Mouse 16,570	Inparanoid OMA EggNOG
Chimp 14,140	OMA EggNOG
Dog 15,073	Inparanoid OMA EggNOG
Rat 15,117	Inparanoid OMA EggNOG
Cow 15,320	Inparanoid EggNOG
Horse 14,252	Inparanoid OMA EggNOG
Opossum 12,230	Inparanoid EggNOG
Pig 10,168	OMA EggNOG
Anole lizard 10,588	Inparanoid OMA EggNOG
Platypus 5,703	Inparanoid OMA EggNOG

UniProt Keyword (4)

Complete proteome 20,231

Polymorphism 12,194

Reference proteome 20,231

Repeat 4,916

Compartment GO Term (1)

cellular_component 18,320

HCA RNA Cell Line (37)

A-431 16,131

A549 15,174

AF22 16,160

ASC TERT1 14,842

BEWO 16,726

BJ 15,448

BJ hTERT+ 15,353

BJ hTERT+ SV40 Large T+ 15,609

BJ hTERT+ SV40 Large T+ RasG12V 15,493

CACO-2 15,436

See all...

Protein-protein Interaction (2)

AA Sequence

MKLPKGTRSSVYFAQHPEKEPLPSRQEVKQTPVIMAKIKGPGPAKYLRPSCTGYIDHDISMFKAPAYTLH      1 - 70
SRHSEKRMVCHSSPGPCYLLDPKITRFGMSSCPQVPMEERISNLRLNPTLASCQYYFEKIHPPGERRAPQ     71 - 140
YTFGYRRPYRVMDLNPAPNQYQMPLLLGPNTPVSRAAPCYSLASRDKNWFYKEDVAGGPGPTTYARPEPS    141 - 210
IYQNRSPTYSMAKRFAYPLDLTPRPGPGSHEVQQVTVHKPHIPAFTMGIKHSLHLCPLVIDIRD          211 - 274
//

Text Mined References (3)

Summary
Details

	PMID	Year	Title