Property Summary

NCBI Gene PubMed Count 12
PubMed Score 24.07
PubTator Score 6.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (5)

AA Sequence

MAPALLLIPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGWLAALQDRSILAPLAWDLGLL      1 - 70
LLFVGQHSLMAAERVKAWTSRYFGVLQRSLYVACTALALQLVMRYWEPIPKGPVLWEARAEPWATWVPLL     71 - 140
CFVLHVISWLLIFSILLVFDYAELMGLKQVYYHVLGLGEPLALKSPRALRLFSHLRHPVCVELLTVLWVV    141 - 210
PTLGTDRLLLAFLLTLYLGLAHGLDQQDLRYLRAQLQRKLHLLSRPQDGEAE                      211 - 262
//

Text Mined References (17)

PMID Year Title