| Tbio | Nurim |
The protein encoded by this gene contains transmembrane domains and resides within the inner nuclear membrane, where it is tightly associated with the nucleus. This protein shares homology with isoprenylcysteine carboxymethyltransferase enzymes. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Jul 2012]
Comments
Property Summary
| NCBI Gene PubMed Count | 12 |
| Grant Count | 5 |
| R01 Count | 5 |
| Funding | $484,356.99 |
| PubMed Score | 19.41 |
| PubTator Score | 6.50 |
| PMID | Text |
|---|---|
| 23092226 | these findings implicate that the inner nuclear membrane protein Nurim plays an important role in the suppression of apoptosis |
| 20628086 | Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) |
| 19913121 | Observational study of gene-disease association. (HuGE Navigator) |
| 19851445 | Observational study of gene-disease association. (HuGE Navigator) |
| 15542857 | nurim is a polytopic protein tightly associated with the inner nuclear membrane |
MAPALLLIPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGWLAALQDRSILAPLAWDLGLL 1 - 70 LLFVGQHSLMAAERVKAWTSRYFGVLQRSLYVACTALALQLVMRYWEPIPKGPVLWEARAEPWATWVPLL 71 - 140 CFVLHVISWLLIFSILLVFDYAELMGLKQVYYHVLGLGEPLALKSPRALRLFSHLRHPVCVELLTVLWVV 141 - 210 PTLGTDRLLLAFLLTLYLGLAHGLDQQDLRYLRAQLQRKLHLLSRPQDGEAE 211 - 262 //
| PMID | Year | Title |
|---|---|---|
| 25416956 | 2014 | A proteome-scale map of the human interactome network. |
| 23092226 | 2012 | The integral nuclear membrane protein nurim plays a role in the suppression of apoptosis. |
| 19946888 | 2010 | Defining the membrane proteome of NK cells. |
| 17517639 | 2007 | Early sorting of inner nuclear membrane proteins is conserved. |
| 17207965 | 2007 | hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes. |
| 16702430 | 2006 | Rapid evolution of major histocompatibility complex class I genes in primates generates new disease alleles in humans via hitchhiking diversity. |
| 16344560 | 2006 | Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. |
| 16341674 | 2005 | Transcriptome analysis of human gastric cancer. |
| 16303743 | 2005 | Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries. |
| 15542857 | 2005 | Analysis of the localization and topology of nurim, a polytopic protein tightly associated with the inner nuclear membrane. |
| More... |
