Property Summary

NCBI Gene PubMed Count 19
PubMed Score 5.20
PubTator Score 6.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.800 1.7e-04
atypical teratoid / rhabdoid tumor -1.400 7.2e-07
glioblastoma -1.100 3.2e-03
group 4 medulloblastoma -1.500 1.1e-04
medulloblastoma, large-cell -1.900 2.8e-06
osteosarcoma 1.722 2.7e-05
ovarian cancer 1.100 8.8e-04
primary pancreatic ductal adenocarcinoma 1.060 4.4e-03
primitive neuroectodermal tumor -1.100 1.1e-02

 MGI Phenotype (1)

Gene RIF (7)

AA Sequence

MGVLAAAARCLVRGADRMSKWTSKRGPRSFRGRKGRGAKGIGFLTSGWRFVQIKEMVPEFVVPDLTGFKL      1 - 70
KPYVSYLAPESEETPLTAAQLFSEAVAPAIEKDFKDGTFDPDNLEKYGFEPTQEGKLFQLYPRNFLR        71 - 137
//

Text Mined References (22)

PMID Year Title