Property Summary

NCBI Gene PubMed Count 19
Grant Count 4
Funding $403,822
PubMed Score 5.20
PubTator Score 6.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 1.722 0.000
medulloblastoma -1.500 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.100 0.003
medulloblastoma, large-cell -1.900 0.000
primitive neuroectodermal tumor -1.100 0.011
primary pancreatic ductal adenocarcinoma 1.060 0.004
adult high grade glioma -1.800 0.000
ovarian cancer 3.100 0.000

Synonym

Accession Q8IXM3 Q96Q49 L41mt
Symbols BMRP
PIG3
MRPL27
RPML27
MRP-L27

Gene

PDB

3J9M   3J7Y  

Gene RIF (7)

PMID Text
24160266 Nuclear-encoded mitochondrial MTO1 and MRPL41 are regulated in an opposite epigenetic mode based on estrogen receptor status in breast cancer.
22711503 Apoptosis-inducing ability of wild-type BMRP is blocked by Bcl-2 through several mechanisms.
21253851 region of BMRP required for the interaction with Bcl-2 is very relevant for the cell death-inducing activity of the protein
20877624 Observational study of gene-disease association. (HuGE Navigator)
16256947 Overall, these results suggest that MRPL41 arrests the cell cycle by increasing the p21(WAF1/CIP1) and p27(Kip1) levels under the growth inhibitory conditions.
16024796 mitochondrial ribosomal protein L41 (MRPL41) is localized in the mitochondria, stabilizes the p53 protein, and enhances its translocation to the mitochondria, thereby inducing apoptosis.
15547950 BMRP is a mitochondrial ribosomal protein involved in the regulation of cell death by apoptosis, probably affecting pathways mediated by Bcl-2 and caspases.

AA Sequence

MGVLAAAARCLVRGADRMSKWTSKRGPRSFRGRKGRGAKGIGFLTSGWRFVQIKEMVPEFVVPDLTGFKL      1 - 70
KPYVSYLAPESEETPLTAAQLFSEAVAPAIEKDFKDGTFDPDNLEKYGFEPTQEGKLFQLYPRNFLR        71 - 137
//

Text Mined References (21)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
24160266 2013 Nuclear-encoded mitochondrial MTO1 and MRPL41 are regulated in an opposite epigenetic mode based on estrogen receptor status in breast cancer.
22711503 2012 Identification of a motif in BMRP required for interaction with Bcl-2 by site-directed mutagenesis studies.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
21253851 2011 Deletion mutational analysis of BMRP, a pro-apoptotic protein that binds to Bcl-2.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18157088 2008 Cooperative control of striated muscle mass and metabolism by MuRF1 and MuRF2.
More...