Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.75
PubTator Score 1.08

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count Z-score Confidence
Osteonecrosis 25 3.012 1.5



Accession Q8IXM2 B4DIV3 C9J4G0 E9PB29
Symbols BAP18


PANTHER Protein Class (1)

  Ortholog (2)

Species Source
Cow EggNOG Inparanoid
Xenopus EggNOG Inparanoid

AA Sequence

SALNDSDANSDVVDIEGLGETPPAKKLNFDQA                                          141 - 172

Text Mined References (14)

PMID Year Title
27226492 2016 BAP18 coactivates androgen receptor action and promotes prostate cancer progression.
25456412 2014 Molecular basis for DPY-30 association to COMPASS-like and NURF complexes.
20850016 2010 Quantitative interaction proteomics and genome-wide profiling of epigenetic histone marks and their readers.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15960975 2005 Physical association and coordinate function of the H3 K4 methyltransferase MLL1 and the H4 K16 acetyltransferase MOF.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.