Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.75
PubTator Score 1.08

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MTSASTKVGEIFSAAGAAFTKLGELTMQLHPVADSSPAGAKWTETEIEMLRAAVKRFGDDLNHISCVIKE      1 - 70
RTVAQIKATVKRKVYEDSGIPLPAESPKKGPKKVASGVLSPPPAAPPPSSSSVPEAGGPPIKKQKADVTL     71 - 140
SALNDSDANSDVVDIEGLGETPPAKKLNFDQA                                          141 - 172
//

Text Mined References (15)

PMID Year Title