Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

 GO Function (1)

 Compartment GO Term (0)

 HCA RNA Cell Line (3)

Protein-protein Interaction (10)

AA Sequence

MRVRFCTKGNLILVIIEDVEESIEWKTLQKKKQQKIKEKLRIRTKAAVKIQAWWRGTLVRRTLLHAALRA      1 - 70
WIIQCWWRMTLSRVLEKKRQAALIAYATRERAVIKLQSLVRMWRVRWRYCQVLNAIYIIQGHWQCHNCQT     71 - 140
CALLQGHCVVTATHLQFHIEIINS                                                  141 - 164
//

Text Mined References (5)

PMID Year Title