Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q8IXL9
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 Compartment GO Term (0)

 HCA RNA Cell Line (3)

Protein-protein Interaction (10)

AA Sequence

MRVRFCTKGNLILVIIEDVEESIEWKTLQKKKQQKIKEKLRIRTKAAVKIQAWWRGTLVRRTLLHAALRA      1 - 70
WIIQCWWRMTLSRVLEKKRQAALIAYATRERAVIKLQSLVRMWRVRWRYCQVLNAIYIIQGHWQCHNCQT     71 - 140
CALLQGHCVVTATHLQFHIEIINS                                                  141 - 164
//

Text Mined References (5)

PMID Year Title