Property Summary

NCBI Gene PubMed Count 22
Grant Count 8
R01 Count 5
Funding $1,752,152.63
PubMed Score 17.23
PubTator Score 16.38

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
24583268 MsrB3 deficiency activates the cell cycle inhibitors p21 and p27.
22422452 DNA methylation shows genome-wide association of NFIX, RAPGEF2 and MSRB3 with gestational age at birth.
22405767 these data provide evidence that the ER-type of MsrB3 plays an important role in protection against ER stress, suggesting that MsrB3 may be involved in the regulation of ER homeostasis.
22310715 Taken together, these data provide evidence that the ER type of MsrB, MsrB3A, plays an important role in protection mechanisms against oxidative, cold and heat stresses and, moreover, in the regulation of fruit fly aging.
22027001 Results identified an antimicrobial peptide from the human methionine sulfoxide reductase B3 protein.
21185009 an in vitro assay revealed that p.Cys89Gly completely abolished MSRB3 enzymatic activity and that p.Arg19X is a null allele for MSRB3 mitochondrial isoforms, indicating that DFNB74 deafness might be a mitochondrial disease limited to the inner ear.
20195514 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MSPRRTLPRPLSLCLSLCLCLCLAAALGSAQSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESA      1 - 70
FEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGA     71 - 140
HLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL                      141 - 192
//

Text Mined References (26)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24583268 2014 Methionine sulfoxide reductase B3 deficiency inhibits cell growth through the activation of p53-p21 and p27 pathways.
23704328 2013 Genome-wide association study of primary tooth eruption identifies pleiotropic loci associated with height and craniofacial distances.
22832960 2012 A genome-wide meta-analysis of association studies of Cloninger's Temperament Scales.
22504421 2012 Common variants at 12q14 and 12q24 are associated with hippocampal volume.
22422452 2012 DNA methylation shows genome-wide association of NFIX, RAPGEF2 and MSRB3 with gestational age at birth.
22405767 2012 Methionine sulfoxide reductase B3 protects from endoplasmic reticulum stress in Drosophila and in mammalian cells.
22310715 2012 Methionine sulfoxide reductase B in the endoplasmic reticulum is critical for stress resistance and aging in Drosophila.
22027001 2011 Identification of an antimicrobial peptide from human methionine sulfoxide reductase B3.
21185009 2011 Functional null mutations of MSRB3 encoding methionine sulfoxide reductase are associated with human deafness DFNB74.
More...