Property Summary

NCBI Gene PubMed Count 30
PubMed Score 210.29
PubTator Score 40.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma 1.100 3.8e-03
Astrocytoma, Pilocytic 1.600 9.4e-09
Breast cancer -1.200 7.4e-05
cystic fibrosis 2.593 3.2e-07
glioblastoma multiforme 1.700 1.0e-16
group 4 medulloblastoma -2.300 6.6e-06
interstitial cystitis 1.800 3.6e-04
ovarian cancer 2.100 8.5e-07
pancreatic cancer 1.500 2.6e-03
pancreatic ductal adenocarcinoma liver m... -1.459 7.4e-03
ulcerative colitis 1.500 1.2e-04

 OMIM Phenotype (1)

Gene RIF (19)

AA Sequence

MKMMLVRRFRVLILMVFLVACALHIALDLLPRLERRGARPSGEPGCSCAQPAAEVAAPGWAQVRGRPGEP      1 - 70
PAASSAAGDAGWPNKHTLRILQDFSSDPSSNLSSHSLEKLPPAAEPAERALRGRDPGALRPHDPAHRPLL     71 - 140
RDPGPRRSESPPGPGGDASLLARLFEHPLYRVAVPPLTEEDVLFNVNSDTRLSPKAAENPDWPHAGAEGA    141 - 210
EFLSPGEAAVDSYPNWLKFHIGINRYELYSRHNPAIEALLHDLSSQRITSVAMKSGGTQLKLIMTFQNYG    211 - 280
QALFKPMKQTREQETPPDFFYFSDYERHNAEIAAFHLDRILDFRRVPPVAGRMVNMTKEIRDVTRDKKLW    281 - 350
RTFFISPANNICFYGECSYYCSTEHALCGKPDQIEGSLAAFLPDLSLAKRKTWRNPWRRSYHKRKKAEWE    351 - 420
VDPDYCEEVKQTPPYDSSHRILDVMDMTIFDFLMGNMDRHHYETFEKFGNETFIIHLDNGRGFGKYSHDE    421 - 490
LSILVPLQQCCRIRKSTYLRLQLLAKEEYKLSLLMAESLRGDQVAPVLYQPHLEALDRRLRVVLKAVRDC    491 - 560
VERNGLHSVVDDDLDTEHRAASAR                                                  561 - 584
//

Text Mined References (33)

PMID Year Title