Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.75
PubTator Score 9.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Atopic dermatitis -1.300 7.0e-04
atypical teratoid / rhabdoid tumor 2.000 6.2e-03
colon cancer -1.700 2.3e-02
cystic fibrosis 1.785 2.2e-05
group 3 medulloblastoma 2.500 1.4e-02
Hydrolethalus syndrome -1.479 3.0e-02
interstitial cystitis -1.400 3.9e-04
intraductal papillary-mucinous adenoma (... 2.600 1.6e-04
intraductal papillary-mucinous carcinoma... 2.700 1.5e-04
intraductal papillary-mucinous neoplasm ... 2.400 5.2e-03
invasive ductal carcinoma -1.400 3.8e-02
lung adenocarcinoma 1.063 7.0e-04
lung cancer -2.000 8.0e-05
malignant mesothelioma -4.400 1.6e-09
Multiple myeloma 1.771 6.1e-04
nasopharyngeal carcinoma -1.500 2.6e-02
ovarian cancer -2.100 3.5e-06
pituitary cancer 4.100 5.0e-07
psoriasis -1.300 1.9e-05
ulcerative colitis -1.600 9.3e-06

Gene RIF (8)

AA Sequence

MWGRTARRRCPRELRRGREALLVLLALLALAGLGSVLRAQRGAGAGAAEPGPPRTPRPGRREPVMPRPPV      1 - 70
PANALGARGEAVRLQLQGEELRLQEESVRLHQINIYLSDRISLHRRLPERWNPLCKEKKYDYDNLPRTSV     71 - 140
IIAFYNEAWSTLLRTVYSVLETSPDILLEEVILVDDYSDREHLKERLANELSGLPKVRLIRANKREGLVR    141 - 210
ARLLGASAARGDVLTFLDCHCECHEGWLEPLLQRIHEEESAVVCPVIDVIDWNTFEYLGNSGEPQIGGFD    211 - 280
WRLVFTWHTVPERERIRMQSPVDVIRSPTMAGGLFAVSKKYFEYLGSYDTGMEVWGGENLEFSFRIWQCG    281 - 350
GVLETHPCSHVGHVFPKQAPYSRNKALANSVRAAEVWMDEFKELYYHRNPRARLEPFGDVTERKQLRDKL    351 - 420
QCKDFKWFLETVYPELHVPEDRPGFFGMLQNKGLTDYCFDYNPPDENQIVGHQVILYLCHGMGQNQFFEY    421 - 490
TSQKEIRYNTHQPEGCIAVEAGMDTLIMHLCEETAPENQKFILQEDGSLFHEQSKKCVQAARKESSDSFV    491 - 560
PLLRDCTNSDHQKWFFKERML                                                     561 - 581
//

Text Mined References (12)

PMID Year Title