Property Summary

NCBI Gene PubMed Count 25
PubMed Score 167.35
PubTator Score 410.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 5.2e-07
group 3 medulloblastoma 4104 1.4e-04
psoriasis 6694 1.6e-04
glioblastoma 5792 1.4e-03
astrocytoma 1146 3.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytoma 1.100 3.8e-02
glioblastoma 1.600 1.4e-03
group 3 medulloblastoma 1.200 1.4e-04
ovarian cancer 1.900 5.2e-07
psoriasis 1.600 1.6e-04

Gene RIF (2)

AA Sequence

MENELPVPHTSSSACATSSTSGASSSSGCNNSSSGGSGRPTGPQISVYSGIPDRQTVQVIQQALHRQPST      1 - 70
AAQYLQQMYAAQQQHLMLQTAALQQQHLSSAQLQSLAAVQQASLVSNRQGSTSGSNVSAQAPAQSSSINL     71 - 140
AASPAAAQLLNRAQSVNSAAASGIAQQAVLLGNTSSPALTASQAQMYLRAQMLIFTPTATVATVQPELGT    141 - 210
GSPARPPTPAQVQNLTLRTQQTPAAAASGPTPTQPVLPSLALKPTPGGSQPLPTPAQSRNTAQASPAGAK    211 - 280
PGIADSVMEPHKKGDGNSSVPGSMEGRAGLSRTVPAVAAHPLIAPAYAQLQPHQLLPQPSSKHLQPQFVI    281 - 350
QQQPQPQQQQPPPQQSRPVLQAEPHPQLASVSPSVALQPSSEAHAMPLGPVTPALPLQCPTANLHKPGGS    351 - 420
QQCHPPTPDTGPQNGHPEGVPHTPQRRFQHTSAVILQLQPASPPQQCVPDDWKEVAPGEKSVPETRSGPS    421 - 490
PHQQAIVTAMPGGLPVPTSPNIQPSPAHETGQGIVHALTDLSSPGMTSGNGNSASSIAGTAPQNGENKPP    491 - 560
QAIVKPQILTHVIEGFVIQEGAEPFPVGRSSLLVGNLKKKYAQGFLPEKLPQQDHTTTTDSEMEEPYLQE    561 - 630
SKEEGAPLKLKCELCGRVDFAYKFKRSKRFCSMACAKRYNVGCTKRVGLFHSDRSKLQKAGAATHNRRRA    631 - 700
SKASLPPLTKDTKKQPTGTVPLSVTAALQLTHSQEDSSRCSDNSSYEEPLSPISASSSTSRRRQGQRDLE    701 - 770
LPDMHMRDLVGMGHHFLPSEPTKWNVEDVYEFIRSLPGCQEIAEEFRAQEIDGQALLLLKEDHLMSAMNI    771 - 840
KLGPALKIYARISMLKDS                                                        841 - 858
//

Text Mined References (31)

PMID Year Title