Property Summary

NCBI Gene PubMed Count 103
PubMed Score 173.82
PubTator Score 120.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Craniosynostosis 74 0.0 4.0

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma 1.300 5.2e-05
astrocytic glioma 1.500 1.3e-03
atypical teratoid / rhabdoid tumor 1.200 1.5e-05
ependymoma 1.200 3.8e-02
glioblastoma 1.600 3.7e-09
group 3 medulloblastoma 1.200 7.6e-04
intraductal papillary-mucinous adenoma (... 1.400 1.1e-02
intraductal papillary-mucinous carcinoma... 1.600 6.9e-03
invasive ductal carcinoma 1.100 2.0e-02
malignant mesothelioma 1.300 9.3e-07
medulloblastoma, large-cell 1.600 6.6e-04
oligodendroglioma 1.800 2.7e-03
osteosarcoma -1.769 2.0e-05
ovarian cancer -1.100 4.2e-07
pancreatic ductal adenocarcinoma liver m... 1.235 5.6e-03
Pick disease 1.300 3.7e-07
pituitary cancer -1.200 5.8e-03
primitive neuroectodermal tumor 1.300 5.3e-04
psoriasis 1.200 2.1e-03
spina bifida -1.542 2.9e-02
tuberculosis and treatment for 6 months 1.300 1.4e-04

Protein-protein Interaction (3)

Gene RIF (88)

AA Sequence

MKDKQKKKKERTWAEAARLVLENYSDAPMTPKQILQVIEAEGLKEMRSGTSPLACLNAMLHSNSRGGEGL      1 - 70
FYKLPGRISLFTLKKDALQWSRHPATVEGEEPEDTADVESCGSNEASTVSGENDVSLDETSSNASCSTES     71 - 140
QSRPLSNPRDSYRASSQANKQKKKTGVMLPRVVLTPLKVNGAHVESASGFSGCHADGESGSPSSSSSGSL    141 - 210
ALGSAAIRGQAEVTQDPAPLLRGFRKPATGQMKRNRGEEIDFETPGSILVNTNLRALINSRTFHALPSHF    211 - 280
QQQLLFLLPEVDRQVGTDGLLRLSSSALNNEFFTHAAQSWRERLADGEFTHEMQVRIRQEMEKEKKVEQW    281 - 350
KEKFFEDYYGQKLGLTKEESLQQNVGQEEAEIKSGLCVPGESVRIQRGPATRQRDGHFKKRSRPDLRTRA    351 - 420
RRNLYKKQESEQAGVAKDAKSVASDVPLYKDGEAKTDPAGLSSPHLPGTSSAAPDLEGPEFPVESVASRI    421 - 490
QAEPDNLARASASPDRIPSLPQETVDQEPKDQKRKSFEQAASASFPEKKPRLEDRQSFRNTIESVHTEKP    491 - 560
QPTKEEPKVPPIRIQLSRIKPPWVVKGQPTYQICPRIIPTTESSCRGWTGARTLADIKARALQVRGARGH    561 - 630
HCHREAATTAIGGGGGPGGGGGGATDEGGGRGSSSGDGGEACGHPEPRGGPSTPGKCTSDLQRTQLLPPY    631 - 700
PLNGEHTQAGTAMSRARREDLPSLRKEESCLLQRATVGLTDGLGDASQLPVAPTGDQPCQALPLLSSQTS    701 - 770
VAERLVEQPQLHPDVRTECESGTTSWESDDEEQGPTVPADNGPILSLVGDDTLEKGTGQALDSHPTMKDP    771 - 840
VNVTPSSTPESSPTDCLQNRAFDDELGLGGSCPPMRESDTRQENLKTKALVSNSSLHWIPIPSNDEVVKQ    841 - 910
PKPESREHIPSVEPQVGEEWEKAAPTPPALPGDLTAEEGLDPLDSLTSLWTVPSRGGSDSNGSYCQQVDI    911 - 980
EKLKINGDSEALSPHGESTDTASDFEGHLTEDSSEADTREAAVTKGSSVDKDEKPNWNQSAPLSKVNGDM    981 - 1050
RLVTRTDGMVAPQSWVSRVCAVRQKIPDSLLLASTEYQPRAVCLSMPGSSVEATNPLVMQLLQGSLPLEK   1051 - 1120
VLPPAHDDSMSESPQVPLTKDQSHGSLRMGSLHGLGKNSGMVDGSSPSSLRALKEPLLPDSCETGTGLAR   1121 - 1190
IEATQAPGAPQKNCKAVPSFDSLHPVTNPITSSRKLEEMDSKEQFSSFSCEDQKEVRAMSQDSNSNAAPG   1191 - 1260
KSPGDLTTSRTPRFSSPNVISFGPEQTGRALGDQSNVTGQGKKLFGSGNVAATLQRPRPADPMPLPAEIP   1261 - 1330
PVFPSGKLGPSTNSMSGGVQTPREDWAPKPHAFVGSVKNEKTFVGGPLKANAENRKATGHSPLELVGHLE   1331 - 1400
GMPFVMDLPFWKLPREPGKGLSEPLEPSSLPSQLSIKQAFYGKLSKLQLSSTSFNYSSSSPTFPKGLAGS   1401 - 1470
VVQLSHKANFGASHSASLSLQMFTDSSTVESISLQCACSLKAMIMCQGCGAFCHDDCIGPSKLCVLCLVV   1471 - 1540
R//

Text Mined References (107)

PMID Year Title