Property Summary

NCBI Gene PubMed Count 115
Grant Count 583
R01 Count 403
Funding $68,884,227.41
PubMed Score 642.82
PubTator Score 251.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 3.028 0.000
medulloblastoma, large-cell -1.200 0.000
adrenocortical carcinoma 1.060 0.001
group 4 medulloblastoma -1.100 0.000

Synonym

Accession Q8IXJ6 A8K3V1 B2RB45 O95889 Q924Y7 Q9P0G8 Q9UNT0 Q9Y6E9 U5TP13
Symbols SIR2
SIR2L
SIR2L2

Gene

PDB

5FYQ   1J8F   3ZGO   3ZGV   4L3O   4R8M   4RMG   4RMH   4RMI   4RMJ   4X3O   4X3P   4Y6L   4Y6O   4Y6Q   5D7O   5D7P   5D7Q   5DY4   5DY5  

Gene RIF (86)

PMID Text
26808575 Under hypoxic conditions, SIRT2 inhibition increased the ubiquitination of HIF-1alpha in a VHL-dependent manner, leading to the degradation of HIF-1alpha via a proteasomal pathway.
26625292 microseed matrix seeding (MMS) was used to obtain crystals of human Sirt3 in its apo form and of human Sirt2 in complex with ADP ribose (ADPR).
26538315 Emerging Role of Sirtuin 2 in the Regulation of Mammalian Metabolism
26303530 The study reports the formation of a multiprotein complex at the G2-to-M transition in vitro and in vivo. Group IVA cytosolic phospholipase A2 (cPLA2-alpha) acts as a bridge in this complex to promote binding of SIRT2 to cyclin A-Cdk2.
26001219 Use of a pan-sirtuin inhibitor and shRNA-mediated protein knockdown led us to uncover a role for the NAD(+)-dependent family of sirtuins, and in particular for SIRT2 and SIRT5, in the regulation of the necroptotic cell death program
25960087 Regulation of protein acetylation by SIRT2 plays a central role in platelet function. The effects of SIRT2 are mediated in part by the acetylation and inhibition of Akt.
25934993 Two polymorphisms,SIRT2-rs45592833 G/T and DRD2-rs6276 A/G, provided a significant association with human longevity.
25924011 In conclusion our data reveal that resveratrol induced premature senescence is associated with SIRT1 and SIRT2 down regulation in human dermal fibroblasts
25915617 Expression of sirtuin 1 and 2 is associated with poor prognosis in non-small cell lung cancer patients
25829495 Sirt1, Sirt2, and Sirt3 are expressed in enucleate platelets. Sirtuins act as a central player in the determination of platelet aging.
More...

AA Sequence

MAEPDPSHPLETQAGKVQEAQDSDSDSEGGAAGGEADMDFLRNLFSQTLSLGSQKERLLDELTLEGVARY      1 - 70
MQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYP     71 - 140
GQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMK    141 - 210
EKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLST    211 - 280
PRLLINKEKAGQSDPFLGMIMGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHA    281 - 350
SIDAQSGAGVPNPSTSASPKKSPPPAKDEARTTEREKPQ                                   351 - 389
//

Text Mined References (132)

PMID Year Title
26808575 2016 AK-1, a SIRT2 inhibitor, destabilizes HIF-1? and diminishes its transcriptional activity during hypoxia.
26625292 2015 Seeding for sirtuins: microseed matrix seeding to obtain crystals of human Sirt3 and Sirt2 suitable for soaking.
26538315 2015 Emerging Role of Sirtuin 2 in the Regulation of Mammalian Metabolism.
26303530 2015 Group IVA Cytosolic Phospholipase A2 Regulates the G2-to-M Transition by Modulating the Activity of Tumor Suppressor SIRT2.
26001219 2016 Intracellular nicotinamide adenine dinucleotide promotes TNF-induced necroptosis in a sirtuin-dependent manner.
25960087 2015 The histone deacetylase sirtuin 2 is a new player in the regulation of platelet function.
25934993 2016 Polymorphisms Falling Within Putative miRNA Target Sites in the 3'UTR Region of SIRT2 and DRD2 Genes Are Correlated With Human Longevity.
25924011 2015 Resveratrol Induced Premature Senescence Is Associated with DNA Damage Mediated SIRT1 and SIRT2 Down-Regulation.
25915617 2015 Expression of sirtuin 1 and 2 is associated with poor prognosis in non-small cell lung cancer patients.
25829495 2015 Sirtuin Inhibition Induces Apoptosis-like Changes in Platelets and Thrombocytopenia.
More...