Property Summary

Ligand Count 137
NCBI Gene PubMed Count 142
PubMed Score 706.15
PubTator Score 251.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
adrenocortical carcinoma 1.060 5.0e-04
group 4 medulloblastoma -1.100 4.1e-04
medulloblastoma, large-cell -1.200 4.1e-05
osteosarcoma 3.028 5.5e-06

Protein-protein Interaction (10)

Gene RIF (113)

AA Sequence

MAEPDPSHPLETQAGKVQEAQDSDSDSEGGAAGGEADMDFLRNLFSQTLSLGSQKERLLDELTLEGVARY      1 - 70
MQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYP     71 - 140
GQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMK    141 - 210
EKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLST    211 - 280
PRLLINKEKAGQSDPFLGMIMGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHA    281 - 350
SIDAQSGAGVPNPSTSASPKKSPPPAKDEARTTEREKPQ                                   351 - 389
//

Text Mined References (160)

PMID Year Title