Property Summary

NCBI Gene PubMed Count 19
Grant Count 28
R01 Count 5
Funding $5,508,011.54
PubMed Score 19.78
PubTator Score 11.96

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
26259702 Miro and Cenp-F promote anterograde mitochondrial movement and proper mitochondrial distribution in daughter cells.
24256248 The Miro2-mediated mitochondrial transport in neurons and recently highlighted involvement of Miro2 proteins in mitochondrial turnover, emerging as a key process affected in neurodegeneration.
22078885 Study shows that both PINK1 and Parkin halt mitochondrial movement; PINK1 phosphorylates Miro (1 and 2) and thereby initiates the rapid degradation of Miro through a Parkin- and proteasome-dependent pathway.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19098100 Miro proteins serve as a [Ca(2+)](c)-sensitive switch and bifunctional regulator for both the motility and fusion-fission dynamics of the mitochondria.
16630562 Moreover, we show that Miro interacts with the Kinesin-binding proteins, GRIF-1 and OIP106, suggesting that the Miro GTPases form a link between the mitochondria and the trafficking apparatus of the microtubules.

AA Sequence

MRRDVRILLLGEAQVGKTSLILSLVGEEFPEEVPPRAEEITIPADVTPEKVPTHIVDYSEAEQTDEELRE      1 - 70
EIHKANVVCVVYDVSEEATIEKIRTKWIPLVNGGTTQGPRVPIILVGNKSDLRSGSSMEAVLPIMSQFPE     71 - 140
IETCVECSAKNLRNISELFYYAQKAVLHPTAPLYDPEAKQLRPACAQALTRIFRLSDQDLDQALSDEELN    141 - 210
AFQKSCFGHPLAPQALEDVKTVVCRNVAGGVREDRLTLDGFLFLNTLFIQRGRHETTWTILRRFGYSDAL    211 - 280
ELTADYLSPLIHVPPGCSTELNHLGYQFVQRVFEKHDQDRDGALSPVELQSLFSVFPAAPWGPELPRTVR    281 - 350
TEAGRLPLHGYLCQWTLVTYLDVRSCLGHLGYLGYPTLCEQDQAHAITVTREKRLDQEKGQTQRSVLLCK    351 - 420
VVGARGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILCEVGTDGLLATSLDATCDVAC    421 - 490
LMFDGSDPKSFAHCASVYKHHYMDGQTPCLFVSSKADLPEGVAVSGPSPAEFCRKHRLPAPVPFSCAGPA    491 - 560
EPSTTIFTQLATMAAFPHLVHAELHPSSFWLRGLLGVVGAAVAAVLSFSLYRVLVKSQ                561 - 618
//

Text Mined References (22)

PMID Year Title
26259702 2015 Mitotic redistribution of the mitochondrial network by Miro and Cenp-F.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24995978 2014 Glucose regulates mitochondrial motility via Milton modification by O-GlcNAc transferase.
24256248 2013 Mitochondrial trafficking in neurons and the role of the Miro family of GTPase proteins.
23446634 2013 Genome-wide association analysis of red blood cell traits in African Americans: the COGENT Network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22078885 2011 PINK1 and Parkin target Miro for phosphorylation and degradation to arrest mitochondrial motility.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19946888 2010 Defining the membrane proteome of NK cells.
More...