Property Summary

NCBI Gene PubMed Count 32
PubMed Score 448.82
PubTator Score 4859.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
diabetes mellitus -1.100 2.9e-03
lung adenocarcinoma 1.033 1.4e-05
lung cancer 1.200 4.6e-02
Multiple myeloma 1.008 7.4e-04
ovarian cancer 1.400 4.8e-04

 GO Function (1)

Protein-protein Interaction (3)

Gene RIF (19)

AA Sequence

MAGAVPGAIMDEDYYGSAAEWGDEADGGQQEDDSGEGEDDAEVQQECLHKFSTRDYIMEPSIFNTLKRYF      1 - 70
QAGGSPENVIQLLSENYTAVAQTVNLLAEWLIQTGVEPVQVQETVENHLKSLLIKHFDPRKADSIFTEEG     71 - 140
ETPAWLEQMIAHTTWRDLFYKLAEAHPDCLMLNFTVKLISDAGYQGEITSVSTACQQLEVFSRVLRTSLA    141 - 210
TILDGGEENLEKNLPEFAKMVCHGEHTYLFAQAMMSVLAQEEQGGSAVRRIAQEVQRFAQEKGHDASQIT    211 - 280
LALGTAASYPRACQALGAMLSKGALNPADITVLFKMFTSMDPPPVELIRVPAFLDLFMQSLFKPGARINQ    281 - 350
DHKHKYIHILAYAASVVETWKKNKRVSINKDELKSTSKAVETVHNLCCNENKGASELVAELSTLYQCIRF    351 - 420
PVVAMGVLKWVDWTVSEPRYFQLQTDHTPVHLALLDEISTCHQLLHPQVLQLLVKLFETEHSQLDVMEQL    421 - 490
ELKKTLLDRMVHLLSRGYVLPVVSYIRKCLEKLDTDISLIRYFVTEVLDVIAPPYTSDFVQLFLPILEND    491 - 560
SIAGTIKTEGEHDPVTEFIAHCKSNFIMVN                                            561 - 590
//

Text Mined References (34)

PMID Year Title