Property Summary

NCBI Gene PubMed Count 31
PubMed Score 434.21
PubTator Score 4859.91

Knowledge Summary


No data available


  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.008 0.001
lung cancer 1.800 0.000
diabetes mellitus -1.100 0.003
lung adenocarcinoma 1.033 0.000
ovarian cancer 1.400 0.000


Accession Q8IXH7 B4DE06 Q9BYL2 Q9H405 Q9H888 Q9H8T3 Q9NVX5 Q9P029 Q9UGN1 Q9UGN2 Q9UGN3 NELF-C/D
Symbols TH1




  Ortholog (3)

Species Source
Mouse OMA Inparanoid
Pig OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (18)

24158816 NELF represses HIV-1 transcription by pausing the RNA polymerase II complex
23518577 NELF represses HIV-1 transcription by pausing the RNA polymerase II complex
22238675 Trihydrophobin 1 phosphorylation by c-Src regulates MAPK/ERK signaling and cell migration.
20735431 TH1 might play an important role in regulation of proliferation and invasion in human breast cancer.
20069563 These results indicate that TH1 is a novel regulator to control the duration and magnitude of androgen signal transduction and might be directly involved in androgen-related developmental, physiological, and pathological processes.
20028984 diverse transcriptional consequence of NELF-mediated RNAPII pausing in the human genome
19673036 Observational study of gene-disease association. (HuGE Navigator)
19245807 data show that NELF subunits exhibit highly specific subcellular localizations, such as in NELF bodies or in midbodies, and some shuttle actively between the nucleus and cytoplasm; loss of NELF from cells can lead to enlarged and/or multiple nuclei
19136554 TH1 interacts with PAK1 and specifically restricts the activation of MAPK modules through the upstream region of the MAPK pathway, thereby influencing cell migration.
17621989 Maternal serum Th1 cytokines concentrations increase in preterm and term delivery.

AA Sequence

SIAGTIKTEGEHDPVTEFIAHCKSNFIMVN                                            561 - 590

Text Mined References (32)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
23753411 2013 Genomic association analysis of common variants influencing antihypertensive response to hydrochlorothiazide.
22238675 2012 Trihydrophobin 1 phosphorylation by c-Src regulates MAPK/ERK signaling and cell migration.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21269460 2011 Initial characterization of the human central proteome.
20735431 2010 Negative role of trihydrophobin 1 in breast cancer growth and migration.
20069563 2010 Trihydrophobin 1 attenuates androgen signal transduction through promoting androgen receptor degradation.
20028984 2010 Human negative elongation factor activates transcription and regulates alternative transcription initiation.
19946888 2010 Defining the membrane proteome of NK cells.