Property Summary

NCBI Gene PubMed Count 14
Grant Count 7
R01 Count 4
Funding $642,573
PubMed Score 43.79
PubTator Score 382.06

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
22750142 nucleolus integrity is not essential for both DOR nucleo-cytoplasmic shuttling and DOR function on basal autophagy
22470510 Mutation of conserved hydrophobic residues in region 1 of TP53inp2 reduces transcriptional activity, and blocks nuclear exit and autophagic activity under autophagy-activated conditions.
21467300 DOR plays an important role in thyroid hormone-mediated osteoblast differentiation, and a DOR SNP associates with plasma osteocalcin in men.
19934309 Alternative splicing of an exon in the 5' untranslated region of a gene termed TP53INP2 is a key event downstream of hnRNP A2 that is necessary for cells to invade the extracellular matrix.
19056683 TP53INP2 is a novel gene involved in the autophagy of mammalian cells.

AA Sequence

MFQRLSSLFFSTPSPPEDPDCPRAFVSEEDEVDGWLIIDLPDSYAAPPSPGAAPAPAGRPPPAPSLMDES      1 - 70
WFVTPPACFTAEGPGLGPARLQSSPLEDLLIEHPSMSVYVTGSTIVLEPGSPSPLPDAALPDGDLSEGEL     71 - 140
TPARREPRAARHAAPLPARAALLEKAGQVRRLQRARQRAERHALSAKAVQRQNRARESRPRRSKNQSSFI    141 - 210
YQPCQRQFNY                                                                211 - 220
//

Text Mined References (19)

PMID Year Title
27172002 2016 TP53INP2/DOR, a mediator of cell autophagy, promotes rDNA transcription via facilitating the assembly of the POLR1/RNA polymerase I preinitiation complex at rDNA promoters.
26213321 2015 TP53INP2/DOR protein chaperones deacetylated nuclear LC3 to the cytoplasm to promote macroautophagy.
25104271 2015 The combination of TP53INP1, TP53INP2 and AXIN2: potential biomarkers in papillary thyroid carcinoma.
24713655 2014 Autophagy-regulating TP53INP2 mediates muscle wasting and is repressed in diabetes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23728790 2013 mTOR-dependent abnormalities in autophagy characterize human malformations of cortical development: evidence from focal cortical dysplasia and tuberous sclerosis.
22750142 2012 DOR undergoes nucleo-cytoplasmic shuttling, which involves passage through the nucleolus.
22470510 2012 DOR/Tp53inp2 and Tp53inp1 constitute a metazoan gene family encoding dual regulators of autophagy and transcription.
21467300 2011 Role of diabetes- and obesity-related protein in the regulation of osteoblast differentiation.
19934309 2009 hnRNP A2 regulates alternative mRNA splicing of TP53INP2 to control invasive cell migration.
More...