Property Summary

NCBI Gene PubMed Count 14
PubMed Score 43.79
PubTator Score 382.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
posterior fossa group B ependymoma -1.400 6.2e-08
atypical teratoid/rhabdoid tumor -1.900 3.6e-09
primary pancreatic ductal adenocarcinoma 1.236 9.8e-03
tuberculosis -1.200 3.8e-02
pediatric high grade glioma -1.200 6.2e-04
sonic hedgehog group medulloblastoma -1.100 3.4e-03
subependymal giant cell astrocytoma -1.045 4.4e-02
nasopharyngeal carcinoma -1.900 1.1e-08
spina bifida -1.914 3.6e-02
ulcerative colitis -1.300 4.5e-04
pancreatic cancer 1.200 4.0e-02

Gene RIF (5)

PMID Text
22750142 nucleolus integrity is not essential for both DOR nucleo-cytoplasmic shuttling and DOR function on basal autophagy
22470510 Mutation of conserved hydrophobic residues in region 1 of TP53inp2 reduces transcriptional activity, and blocks nuclear exit and autophagic activity under autophagy-activated conditions.
21467300 DOR plays an important role in thyroid hormone-mediated osteoblast differentiation, and a DOR SNP associates with plasma osteocalcin in men.
19934309 Alternative splicing of an exon in the 5' untranslated region of a gene termed TP53INP2 is a key event downstream of hnRNP A2 that is necessary for cells to invade the extracellular matrix.
19056683 TP53INP2 is a novel gene involved in the autophagy of mammalian cells.

AA Sequence

MFQRLSSLFFSTPSPPEDPDCPRAFVSEEDEVDGWLIIDLPDSYAAPPSPGAAPAPAGRPPPAPSLMDES      1 - 70
WFVTPPACFTAEGPGLGPARLQSSPLEDLLIEHPSMSVYVTGSTIVLEPGSPSPLPDAALPDGDLSEGEL     71 - 140
TPARREPRAARHAAPLPARAALLEKAGQVRRLQRARQRAERHALSAKAVQRQNRARESRPRRSKNQSSFI    141 - 210
YQPCQRQFNY                                                                211 - 220
//

Text Mined References (19)

PMID Year Title
27172002 2016 TP53INP2/DOR, a mediator of cell autophagy, promotes rDNA transcription via facilitating the assembly of the POLR1/RNA polymerase I preinitiation complex at rDNA promoters.
26213321 2015 TP53INP2/DOR protein chaperones deacetylated nuclear LC3 to the cytoplasm to promote macroautophagy.
25104271 2015 The combination of TP53INP1, TP53INP2 and AXIN2: potential biomarkers in papillary thyroid carcinoma.
24713655 2014 Autophagy-regulating TP53INP2 mediates muscle wasting and is repressed in diabetes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23728790 2013 mTOR-dependent abnormalities in autophagy characterize human malformations of cortical development: evidence from focal cortical dysplasia and tuberous sclerosis.
22750142 2012 DOR undergoes nucleo-cytoplasmic shuttling, which involves passage through the nucleolus.
22470510 2012 DOR/Tp53inp2 and Tp53inp1 constitute a metazoan gene family encoding dual regulators of autophagy and transcription.
21467300 2011 Role of diabetes- and obesity-related protein in the regulation of osteoblast differentiation.
19934309 2009 hnRNP A2 regulates alternative mRNA splicing of TP53INP2 to control invasive cell migration.
19145107 2009 TP53INP2 is the new guest at the table of self-eating.
19056683 2009 The TP53INP2 protein is required for autophagy in mammalian cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18030323 2007 Identification of a novel modulator of thyroid hormone receptor-mediated action.
17238154 2007 The coding region of TP53INP2, a gene expressed in the developing nervous system, is not altered in a family with autosomal recessive non-progressive infantile ataxia on chromosome 20q11-q13.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.