Property Summary

NCBI Gene PubMed Count 16
PubMed Score 44.32
PubTator Score 382.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 6.9e-05
ependymoma -1.300 3.7e-10
nasopharyngeal carcinoma -1.900 1.1e-08
pancreatic cancer 1.200 4.0e-02
pediatric high grade glioma -1.200 6.2e-04
primary pancreatic ductal adenocarcinoma 1.236 9.8e-03
sonic hedgehog group medulloblastoma -1.100 3.4e-03
spina bifida -1.914 3.6e-02
subependymal giant cell astrocytoma -1.045 4.4e-02
tuberculosis -1.200 3.8e-02
ulcerative colitis -1.300 4.5e-04

 GO Function (1)

Gene RIF (8)

AA Sequence

MFQRLSSLFFSTPSPPEDPDCPRAFVSEEDEVDGWLIIDLPDSYAAPPSPGAAPAPAGRPPPAPSLMDES      1 - 70
WFVTPPACFTAEGPGLGPARLQSSPLEDLLIEHPSMSVYVTGSTIVLEPGSPSPLPDAALPDGDLSEGEL     71 - 140
TPARREPRAARHAAPLPARAALLEKAGQVRRLQRARQRAERHALSAKAVQRQNRARESRPRRSKNQSSFI    141 - 210
YQPCQRQFNY                                                                211 - 220
//

Text Mined References (21)

PMID Year Title