Property Summary

NCBI Gene PubMed Count 35
PubMed Score 32.43
PubTator Score 33.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.100 7.7e-03
Breast cancer -2.400 1.1e-15
ependymoma 1.100 1.3e-02
glioblastoma 1.200 1.0e-04
group 3 medulloblastoma -2.300 7.5e-05
lung adenocarcinoma 1.100 9.5e-04
lung carcinoma 1.800 5.5e-14
medulloblastoma, large-cell -1.900 8.2e-08
oligodendroglioma 1.200 1.3e-03
Pick disease 1.600 6.4e-04

Gene RIF (20)

AA Sequence

MAPTKPSFQQDPSRRERITAQHPLPNQSECRKIYRYDGIYCESTYQNLQALRKEKSRDAARSRRGKENFE      1 - 70
FYELAKLLPLPAAITSQLDKASIIRLTISYLKMRDFANQGDPPWNLRMEGPPPNTSVKVIGAQRRRSPSA     71 - 140
LAIEVFEAHLGSHILQSLDGFVFALNQEGKFLYISETVSIYLGLSQVELTGSSVFDYVHPGDHVEMAEQL    141 - 210
GMKLPPGRGLLSQGTAEDGASSASSSSQSETPEPVESTSPSLLTTDNTLERSFFIRMKSTLTKRGVHIKS    211 - 280
SGYKVIHITGRLRLRVSLSHGRTVPSQIMGLVVVAHALPPPTINEVRIDCHMFVTRVNMDLNIIYCENRI    281 - 350
SDYMDLTPVDIVGKRCYHFIHAEDVEGIRHSHLDLLNKGQCVTKYYRWMQKNGGYIWIQSSATIAINAKN    351 - 420
ANEKNIIWVNYLLSNPEYKDTPMDIAQLPHLPEKTSESSETSDSESDSKDTSGITEDNENSKSDEKGNQS    421 - 490
ENSEDPEPDRKKSGNACDNDMNCNDDGHSSSNPDSRDSDDSFEHSDFENPKAGEDGFGALGAMQIKVERY    491 - 560
VESESDLRLQNCESLTSDSAKDSDSAGEAGAQASSKHQKRKKRRKRQKGGSASRRRLSSASSPGGLDAGL    561 - 630
VEPPRLLSSPNSASVLKIKTEISEPINFDNDSSIWNYPPNREISRNESPYSMTKPPSSEHFPSPQGGGGG    631 - 700
GGGGGGLHVAIPDSVLTPPGADGAAARKTQFGASATAALAPVASDPLSPPLSASPRDKHPGNGGGGGGGG    701 - 770
GGAGGGGPSASNSLLYTGDLEALQRLQAGNVVLPLVHRVTGTLAATSTAAQRVYTTGTIRYAPAEVTLAM    771 - 840
QSNLLPNAHAVNFVDVNSPGFGLDPKTPMEMLYHHVHRLNMSGPFGGAVSAASLTQMPAGNVFTTAEGLF    841 - 910
STLPFPVYSNGIHAAQTLERKED                                                   911 - 933
//

Text Mined References (35)

PMID Year Title