Property Summary

NCBI Gene PubMed Count 6
PubMed Score 360.60
PubTator Score 39.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
breast carcinoma -2.100 0.002
fibroadenoma -2.900 0.014
non primary Sjogren syndrome sicca 1.100 0.019
ductal carcinoma in situ -3.800 0.000
invasive ductal carcinoma -4.200 0.000
ovarian cancer -1.200 0.000
psoriasis -1.500 0.000

Gene RIF (2)

PMID Text
23302999 Aberrant DNA hypermethylation of TUSC5 in breast cancer suggests epigenetic mechanism of cancer associated down-regulation
17689857 These findings may point to participation of Tusc5 in shared adipose-nervous system functions.

AA Sequence

MAHPVQSEFPSAQEPGSAAFLDLPEMEILLTKAENKDDKTLNLSKTLSGPLDLEQNSQGLPFKAISEGHL      1 - 70
EAPLPRSPSRASSRRASSIATTSYAQDQEAPRDYLILAVVACFCPVWPLNLIPLIISIMSRSSMQQGNVD     71 - 140
GARRLGRLARLLSITLIIMGIVIIMVAVTVNFTVQKK                                     141 - 177
//

Text Mined References (7)

PMID Year Title
26629404 2015 TUSC5 regulates insulin-mediated adipose tissue glucose uptake by modulation of GLUT4 recycling.
23302999 2012 Hypermethylation of TUSC5 genes in breast cancer tissue.
22363774 2012 The dispanins: a novel gene family of ancient origin that contains 14 human members.
17689857 2007 Characterization of Tusc5, an adipocyte gene co-expressed in peripheral neurons.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
12660825 2003 Detailed characterization of a homozygously deleted region corresponding to a candidate tumor suppressor locus at distal 17p13.3 in human lung cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.