Property Summary

NCBI Gene PubMed Count 6
PubMed Score 378.03
PubTator Score 39.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
breast carcinoma -2.100 1.9e-03
ductal carcinoma in situ -3.800 1.1e-04
fibroadenoma -2.900 1.4e-02
invasive ductal carcinoma -4.200 3.9e-04
non primary Sjogren syndrome sicca 1.100 1.9e-02
ovarian cancer -1.200 1.8e-04
psoriasis -1.500 4.4e-09

Gene RIF (2)

AA Sequence

MAHPVQSEFPSAQEPGSAAFLDLPEMEILLTKAENKDDKTLNLSKTLSGPLDLEQNSQGLPFKAISEGHL      1 - 70
EAPLPRSPSRASSRRASSIATTSYAQDQEAPRDYLILAVVACFCPVWPLNLIPLIISIMSRSSMQQGNVD     71 - 140
GARRLGRLARLLSITLIIMGIVIIMVAVTVNFTVQKK                                     141 - 177
//

Text Mined References (7)

PMID Year Title