Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q8IX95 Protein cTAGE-3
Symbols CTAGE3
CTAGE-3

Gene

PANTHER Protein Class (2)

 Compartment GO Term (0)

AA Sequence

MTFKGFQMNEEKLEIGIQDASSENCQLQESQKQLLQEAEVWKEQVSELNKQKITFEDSKVHAEQVLNDKE      1 - 70
NHIETLTERLLKIKDQAAVLEEDITDDGNLELEMNSELKDGAYLDNPPKGALKKLIHAAKLNASLTTLEG     71 - 140
ERNQFIFSYLKLIKPGRA                                                        141 - 158
//

Text Mined References (2)

PMID Year Title
12839582 2003 cTAGE: a cutaneous T cell lymphoma associated antigen family with tumor-specific splicing.
11149944 2001 Serological detection of cutaneous T-cell lymphoma-associated antigens.