Property Summary

NCBI Gene PubMed Count 15
PubMed Score 11.52
PubTator Score 9.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 3.5511448627057E-47
adrenocortical carcinoma 1427 7.578472513713E-15
ovarian cancer 8492 4.38650837890679E-10
non-small cell lung cancer 2798 1.24863456588429E-8
pilocytic astrocytoma 3086 2.0906536158922E-6
cystic fibrosis 1670 3.55004700087856E-6
medulloblastoma, large-cell 6234 9.92960913333382E-6
posterior fossa group B ependymoma 1530 1.48749239369465E-5
medulloblastoma 1524 2.23082294358232E-4
atypical teratoid / rhabdoid tumor 4369 4.24416396770886E-4
pancreatic cancer 2300 5.2157422128797E-4
primitive neuroectodermal tumor 3031 0.00109402424290939
Breast cancer 3099 0.00118258751307216
adrenocortical adenoma 134 0.0013096080703692
Atopic dermatitis 944 0.00153887554883121
osteosarcoma 7933 0.0019065206171318
glioblastoma 5572 0.00345743283676883
adult high grade glioma 2148 0.00854077433462983
invasive ductal carcinoma 2950 0.031160017319685
Disease Target Count Z-score Confidence
Paget's disease of bone 28 3.828 1.9

Expression

  Differential Expression (19)

Disease log2 FC p
osteosarcoma 2.690 0.002
cystic fibrosis -2.089 0.000
atypical teratoid / rhabdoid tumor 2.600 0.000
glioblastoma 1.300 0.003
medulloblastoma 1.100 0.000
medulloblastoma, large-cell 1.600 0.000
primitive neuroectodermal tumor 2.200 0.001
Atopic dermatitis -1.100 0.002
adrenocortical adenoma -1.173 0.001
adrenocortical carcinoma -1.986 0.000
non-small cell lung cancer 1.227 0.000
pancreatic cancer 1.200 0.001
adult high grade glioma 1.100 0.009
pilocytic astrocytoma 1.700 0.000
posterior fossa group B ependymoma 1.300 0.000
Breast cancer 1.400 0.001
invasive ductal carcinoma 1.500 0.031
ovarian cancer 1.400 0.000
psoriasis -1.700 0.000

Synonym

Accession Q8IX30 A8K5A3 Q5CZB3 Q86UZ9 Q8NAU9
Symbols CEGF3

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Zebrafish OMA EggNOG

 MGI Term (1)

Gene RIF (6)

PMID Text
24390364 Results indicated that SCUBE3 might be involved in regulating the epithelial-mesenchymal transition (EMT) and malignant progression in NSCLC.
24084593 Scube3 facilitates both TGFbeta and Hh signalling within an overall role of facillating inflammatory angiogenesis.
23420440 results show that SCUBE3 knockdown was associated with lower vascular permeability in the tumor and effectively inhibited the metastatic potential of non-small-cell lung carcinoma
21441952 in lung cancer cells, SCUBE3 could serve as an endogenous autocrine and paracrine ligand of TGF-beta type II receptor, which could regulate TGF-beta receptor signaling and modulate EMT and cancer progression
20546612 Observational study of gene-disease association. (HuGE Navigator)
15234972 may act locally and/or distantly through a proteolytic mechanism, and may play an important role in bone cell biology

AA Sequence

MGSGRVPGLCLLVLLVHARAAQYSKAAQDVDECVEGTDNCHIDAICQNTPRSYKCICKSGYTGDGKHCKD      1 - 70
VDECEREDNAGCVHDCVNIPGNYRCTCYDGFHLAHDGHNCLDVDECAEGNGGCQQSCVNMMGSYECHCRE     71 - 140
GFFLSDNQHTCIQRPEEGMNCMNKNHGCAHICRETPKGGIACECRPGFELTKNQRDCKLTCNYGNGGCQH    141 - 210
TCDDTEQGPRCGCHIKFVLHTDGKTCIETCAVNNGGCDSKCHDAATGVHCTCPVGFMLQPDRKTCKDIDE    211 - 280
CRLNNGGCDHICRNTVGSFECSCKKGYKLLINERNCQDIDECSFDRTCDHICVNTPGSFQCLCHRGYLLY    281 - 350
GITHCGDVDECSINRGGCRFGCINTPGSYQCTCPAGQGRLHWNGKDCTEPLKCQGSPGASKAMLSCNRSG    351 - 420
KKDTCALTCPSRARFLPESENGFTVSCGTPSPRAAPARAGHNGNSTNSNHCHEAAVLSIKQRASFKIKDA    421 - 490
KCRLHLRNKGKTEEAGRITGPGGAPCSECQVTFIHLKCDSSRKGKGRRARTPPGKEVTRLTLELEAEVRA    491 - 560
EETTASCGLPCLRQRMERRLKGSLKMLRKSINQDRFLLRLAGLDYELAHKPGLVAGERAEPMESCRPGQH    561 - 630
RAGTKCVSCPQGTYYHGQTEQCVPCPAGTFQEREGQLSCDLCPGSDAHGPLGATNVTTCAGQCPPGQHSV    631 - 700
DGFKPCQPCPRGTYQPEAGRTLCFPCGGGLTTKHEGAISFQDCDTKVQCSPGHYYNTSIHRCIRCAMGSY    701 - 770
QPDFRQNFCSRCPGNTSTDFDGSTSVAQCKNRQCGGELGEFTGYIESPNYPGNYPAGVECIWNINPPPKR    771 - 840
KILIVVPEIFLPSEDECGDVLVMRKNSSPSSITTYETCQTYERPIAFTARSRKLWINFKTSEANSARGFQ    841 - 910
IPYVTYDEDYEQLVEDIVRDGRLYASENHQEILKDKKLIKAFFEVLAHPQNYFKYTEKHKEMLPKSFIKL    911 - 980
LRSKVSSFLRPYK                                                             981 - 993
//

Text Mined References (16)

PMID Year Title
24849422 2014 [Role of SCUBE3 in promoting osteosarcoma cell growth and its association with prognosis].
24390364 2013 SCUBE3 overexpression predicts poor prognosis in non-small cell lung cancer.
24084593 2013 Scube regulates synovial angiogenesis-related signaling.
24084050 2013 The role of Vitamin D level and related single nucleotide polymorphisms in Crohn's disease.
23420440 2013 SCUBE3 regulation of early lung cancer angiogenesis and metastatic progression.
21441952 2011 SCUBE3 is an endogenous TGF-? receptor ligand and regulates the epithelial-mesenchymal transition in lung cancer.
21132003 2011 Genome-wide methylation analysis identifies epigenetically inactivated candidate tumour suppressor genes in renal cell carcinoma.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
18391951 2008 Many sequence variants affecting diversity of adult human height.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...