Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
active Crohn's disease 1.421 3.4e-03
adult high grade glioma -1.200 1.8e-03
astrocytic glioma -1.400 1.0e-02
Astrocytoma, Pilocytic -1.100 3.9e-05
intraductal papillary-mucinous adenoma (... 1.400 1.7e-04
invasive ductal carcinoma 1.200 1.9e-02
lung carcinoma 3.200 2.4e-28
osteosarcoma -1.466 1.5e-04
ulcerative colitis 1.200 1.2e-05

Synonym

Accession Q8IX29 Q3T1B2 Q3T1B3 Q3T1B4
Symbols FBX16

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MMAFAPPKNTDGPKMQTKMSTWTPLNHQLLNDRVFEERRALLGKWFDKWTDSQRRRILTGLLERCSLSQQ      1 - 70
KFCCRKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWKNLAELDQLWMLKCLRFNWYI     71 - 140
NFSPTPFEQGIWKKHYIQMVKELHITKPKTPPKDGFVIADVQLVTSNSPEEKQSPLSAFRSSSSLRKKNN    141 - 210
SGEKALPPWRSSDKHPTDIIRFNYLDNRDPMETVQQGRRKRNQMTPDFSRQSHDKKNKLQDRTRLRKAQS    211 - 280
MMSRRNPFPLCP                                                              281 - 292
//

Text Mined References (7)

PMID Year Title