Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.400 0.010
osteosarcoma -1.466 0.000
intraductal papillary-mucinous adenoma (... 1.400 0.000
active Crohn's disease 1.421 0.003
adult high grade glioma -1.200 0.002
pilocytic astrocytoma -1.100 0.000
lung carcinoma 3.200 0.000
invasive ductal carcinoma 1.200 0.019
ulcerative colitis 1.200 0.000

Gene RIF (1)

PMID Text
12243353 FBXO16 was localized to the human chromosome 8p12. The FBXO16 gene consisted of 9 exons that spanned 67,816 bp of human genomic DNA

AA Sequence

MMAFAPPKNTDGPKMQTKMSTWTPLNHQLLNDRVFEERRALLGKWFDKWTDSQRRRILTGLLERCSLSQQ      1 - 70
KFCCRKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWKNLAELDQLWMLKCLRFNWYI     71 - 140
NFSPTPFEQGIWKKHYIQMVKELHITKPKTPPKDGFVIADVQLVTSNSPEEKQSPLSAFRSSSSLRKKNN    141 - 210
SGEKALPPWRSSDKHPTDIIRFNYLDNRDPMETVQQGRRKRNQMTPDFSRQSHDKKNKLQDRTRLRKAQS    211 - 280
MMSRRNPFPLCP                                                              281 - 292
//

Text Mined References (7)

PMID Year Title
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12243353 2002 cDNA cloning and expression analysis of a novel human F-box only protein.
10531035 1999 Identification of a family of human F-box proteins.