Property Summary

NCBI Gene PubMed Count 4
PubMed Score 4.13
PubTator Score 5.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -3.557 0.000
tuberculosis and treatment for 6 months -1.600 0.000
non-small cell lung cancer -4.431 0.000
pancreatic cancer 1.100 0.003
lung adenocarcinoma -3.000 0.000
lung carcinoma -1.900 0.000
ulcerative colitis 1.400 0.008
psoriasis 1.400 0.000

Gene RIF (2)

PMID Text
26846866 The expression of the gene MCEMP1 had the strongest association with stroke of 11,181 genes tested.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 upregulates the expression of chromosome 19 open reading frame 59 (C19orf59; MCEMP1) in peptide-treated PBMCs

AA Sequence

MEVEEIYKHQEVKMQAPAFRDKKQGVSAKNQGAHDPDYENITLAFKNQDHAKGGHSRPTSQVPAQCRPPS      1 - 70
DSTQVPCWLYRAILSLYILLALAFVLCIILSAFIMVKNAEMSKELLGFKRELWNVSNSVQACEERQKRGW     71 - 140
DSVQQSITMVRSKIDRLETTLAGIKNIDTKVQKILEVLQKMPQSSPQ                           141 - 187
//

Text Mined References (5)

PMID Year Title
26846866 2016 Peripheral Blood MCEMP1 Gene Expression as a Biomarker for Stroke Prognosis.
15953541 2005 Identification and expression of a new type II transmembrane protein in human mast cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.