Property Summary

NCBI Gene PubMed Count 4
PubMed Score 4.00
PubTator Score 5.25

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
lung adenocarcinoma -1.400 7.6e-13
lung carcinoma -1.900 4.7e-16
non-small cell lung cancer -4.431 2.4e-32
osteosarcoma -3.557 2.3e-04
pancreatic cancer 1.100 3.4e-03
psoriasis 1.400 4.2e-08
tuberculosis and treatment for 3 months -1.500 1.1e-03
ulcerative colitis 1.400 7.8e-03

 GO Process (1)

Gene RIF (2)

AA Sequence

MEVEEIYKHQEVKMQAPAFRDKKQGVSAKNQGAHDPDYENITLAFKNQDHAKGGHSRPTSQVPAQCRPPS      1 - 70
DSTQVPCWLYRAILSLYILLALAFVLCIILSAFIMVKNAEMSKELLGFKRELWNVSNSVQACEERQKRGW     71 - 140
DSVQQSITMVRSKIDRLETTLAGIKNIDTKVQKILEVLQKMPQSSPQ                           141 - 187
//

Text Mined References (5)

PMID Year Title