Property Summary

NCBI Gene PubMed Count 6
PubMed Score 20.61
PubTator Score 9.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma 1.500 0.010
ependymoma 1.900 0.010
oligodendroglioma 1.500 0.012
glioblastoma 1.500 0.008
group 4 medulloblastoma 1.400 0.000
atypical teratoid/rhabdoid tumor 1.700 0.000
medulloblastoma, large-cell 1.400 0.000
primitive neuroectodermal tumor 1.200 0.000
Breast cancer 2.700 0.031
pediatric high grade glioma 1.300 0.000
ovarian cancer -1.800 0.000

Synonym

Accession Q8IX18 B3KTJ5 C9JR60 Q5JPH4 Q8TC86 Q8WY53 Q9BXM1 Q9H6M9
Symbols PAD
DDX40
ARG147

Gene

AA Sequence

MSRFPAVAGRAPRRQEEGERSRDLQEERLSAVCIADREEKGCTSQEGGTTPTFPIQKQRKKIIQAVRDNS      1 - 70
FLIVTGNTGSGKTTQLPKYLYEAGFSQHGMIGVTQPRKVAAISVAQRVAEEMKCTLGSKVGYQVRFDDCS     71 - 140
SKETAIKYMTDGCLLKHILGDPNLTKFSVIILDEAHERTLTTDILFGLLKKLFQEKSPNRKEHLKVVVMS    141 - 210
ATMELAKLSAFFGNCPIFDIPGRLYPVREKFCNLIGPRDRENTAYIQAIVKVTMDIHLNEMAGDILVFLT    211 - 280
GQFEIEKSCELLFQMAESVDYDYDVQDTTLDGLLILPCYGSMTTDQQRRIFLPPPPGIRKCVISTNISAT    281 - 350
SLTIDGIRYVVDGGFVKQLNHNPRLGLDILEVVPISKSEALQRSGRAGRTSSGKCFRIYSKDFWNQCMPD    351 - 420
HVIPEIKRTSLTSVVLTLKCLAIHDVIRFPYLDPPNERLILEALKQLYQCDAIDRSGHVTRLGLSMVEFP    421 - 490
LPPHLTCAVIKAASLDCEDLLLPIAAMLSVENVFIRPVDPEYQKEAEQRHRELAAKAGGFNDFATLAVIF    491 - 560
EQCKSSGAPASWCQKHWIHWRCLFSAFRVEAQLRELIRKLKQQSDFPKETFEGPKHEVLRRCLCAGYFKN    561 - 630
VARRSVGRTFCTMDGRGSPVHIHPSSALHEQETKLEWIIFHEVLVTTKVYARIVCPIRYEWVRDLLPKLH    631 - 700
EFNAHDLSSVARREVREDARRRWTNKENVKQLKDGISKDVLKKMQRRNDDKSISDARARFLERKQQRTQD    701 - 770
HSDTRKETG                                                                 771 - 779
//

Text Mined References (9)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12522690 2002 Identification of a novel human DDX40gene, a new member of the DEAH-box protein family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8707840 1996 Molecular and functional characterization of the p62 complex, an assembly of nuclear pore complex glycoproteins.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.