Property Summary

NCBI Gene PubMed Count 6
PubMed Score 20.61
PubTator Score 9.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 1.100 2.3e-02
atypical teratoid / rhabdoid tumor 1.600 1.6e-07
Breast cancer 2.000 3.4e-02
ependymoma 1.900 1.0e-02
glioblastoma 1.200 7.1e-09
group 3 medulloblastoma 1.100 4.3e-03
medulloblastoma, large-cell 1.400 1.4e-04
oligodendroglioma 1.500 1.2e-02
ovarian cancer -1.800 2.3e-04
pediatric high grade glioma 1.300 4.3e-06
primitive neuroectodermal tumor 1.200 1.3e-04

Protein-protein Interaction (8)

AA Sequence

MSRFPAVAGRAPRRQEEGERSRDLQEERLSAVCIADREEKGCTSQEGGTTPTFPIQKQRKKIIQAVRDNS      1 - 70
FLIVTGNTGSGKTTQLPKYLYEAGFSQHGMIGVTQPRKVAAISVAQRVAEEMKCTLGSKVGYQVRFDDCS     71 - 140
SKETAIKYMTDGCLLKHILGDPNLTKFSVIILDEAHERTLTTDILFGLLKKLFQEKSPNRKEHLKVVVMS    141 - 210
ATMELAKLSAFFGNCPIFDIPGRLYPVREKFCNLIGPRDRENTAYIQAIVKVTMDIHLNEMAGDILVFLT    211 - 280
GQFEIEKSCELLFQMAESVDYDYDVQDTTLDGLLILPCYGSMTTDQQRRIFLPPPPGIRKCVISTNISAT    281 - 350
SLTIDGIRYVVDGGFVKQLNHNPRLGLDILEVVPISKSEALQRSGRAGRTSSGKCFRIYSKDFWNQCMPD    351 - 420
HVIPEIKRTSLTSVVLTLKCLAIHDVIRFPYLDPPNERLILEALKQLYQCDAIDRSGHVTRLGLSMVEFP    421 - 490
LPPHLTCAVIKAASLDCEDLLLPIAAMLSVENVFIRPVDPEYQKEAEQRHRELAAKAGGFNDFATLAVIF    491 - 560
EQCKSSGAPASWCQKHWIHWRCLFSAFRVEAQLRELIRKLKQQSDFPKETFEGPKHEVLRRCLCAGYFKN    561 - 630
VARRSVGRTFCTMDGRGSPVHIHPSSALHEQETKLEWIIFHEVLVTTKVYARIVCPIRYEWVRDLLPKLH    631 - 700
EFNAHDLSSVARREVREDARRRWTNKENVKQLKDGISKDVLKKMQRRNDDKSISDARARFLERKQQRTQD    701 - 770
HSDTRKETG                                                                 771 - 779
//

Text Mined References (9)

PMID Year Title