Property Summary

NCBI Gene PubMed Count 34
Grant Count 295
R01 Count 82
Funding $107,982,274.03
PubMed Score 958.88
PubTator Score 12.05

Knowledge Summary

Patent

No data available

Expression

Gene

Gene RIF (15)

PMID Text
25610865 this study provides insight into the structure and evolution of DBC1 and CCAR1, which may impact future studies on the biological functions of these proteins.
23975424 Par-4/THAP1 complex and Notch3 competitively regulated pre-mRNA splicing of CCAR1 and affected inversely the survival of T-cell acute lymphoblastic leukemia cells.
22905258 necdin exerts its pro-survival activity by counteracting the action of the pro-apoptotic protein Cell Cycle Apoptosis Regulatory Protein (CCAR1/CARP1)
22266316 CCAR1 is a novel partner of Ngn3 in mediating endocrine differentiation.
21903591 anaphase-promoting complex (APC)-2-cell cycle and apoptosis regulatory protein (CARP)-1 interaction antagonists are novel regulators of cell growth and apoptosis
19520846 CCAR1 is a novel component of Wnt/beta-catenin signaling that plays an important role in transcriptional regulation by beta-catenin.
19460752 Knockdown of cell division cycle and apoptosis regulator 1 (CCAR1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19073175 These results provide the first evidence for the microtubule dependent association of AKAP350A and CCAR1 with RNA stress granules.
18854154 Knockdown of cell division cycle and apoptosis regulator 1 (CCAR1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18722177 CCAR1 regulates expression of key proliferation-inducing genes.
More...

AA Sequence

MAQFGGQKNPPWATQFTATAVSQPAALGVQQPSLLGASPTIYTQQTALAAAGLTTQTPANYQLTQTAALQ      1 - 70
QQAAAAAAALQQQYSQPQQALYSVQQQLQQPQQTLLTQPAVALPTSLSLSTPQPTAQITVSYPTPRSSQQ     71 - 140
QTQPQKQRVFTGVVTKLHDTFGFVDEDVFFQLSAVKGKTPQVGDRVLVEATYNPNMPFKWNAQRIQTLPN    141 - 210
QNQSQTQPLLKTPPAVLQPIAPQTTFGVQTQPQPQSLLQAQISAASITPLLQTQPQPLLQQPQQKAGLLQ    211 - 280
PPVRIVSQPQPARRLDPPSRFSGRNDRGDQVPNRKDDRSRERERERRRSRERSPQRKRSRERSPRRERER    281 - 350
SPRRVRRVVPRYTVQFSKFSLDCPSCDMMELRRRYQNLYIPSDFFDAQFTWVDAFPLSRPFQLGNYCNFY    351 - 420
VMHREVESLEKNMAILDPPDADHLYSAKVMLMASPSMEDLYHKSCALAEDPQELRDGFQHPARLVKFLVG    421 - 490
MKGKDEAMAIGGHWSPSLDGPDPEKDPSVLIKTAIRCCKALTGIDLSVCTQWYRFAEIRYHRPEETHKGR    491 - 560
TVPAHVETVVLFFPDVWHCLPTRSEWETLSRGYKQQLVEKLQGERKEADGEQDEEEKDDGEAKEISTPTH    561 - 630
WSKLDPKTMKVNDLRKELESRALSSKGLKSQLIARLTKQLKVEEQKEEQKELEKSEKEEDEDDDRKSEDD    631 - 700
KEEEERKRQEEIERQRRERRYILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLF    701 - 770
AELFNEMLQRDFGVRIYKSLLSLPEKEDKKEKDKKSKKDERKDKKEERDDETDEPKPKRRKSGDDKDKKE    771 - 840
DRDERKKEDKRKDDSKDDDETEEDNNQDEYDPMEAEEAEDEEDDRDEEEMTKRDDKRDINRYCKERPSKD    841 - 910
KEKEKTQMITINRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQVKKLLNKVVLRESCFYRKLT    911 - 980
DTSKDEENHEESESLQEDMLGNRLLLPTPTVKQESKDVEENVGLIVYNGAMVDVGSLLQKLEKSEKVRAE    981 - 1050
VEQKLQLLEEKTDEDEKTILNLENSNKSLSGELREVKKDLSQLQENLKISENMNLQFENQMNKTIRNLST   1051 - 1120
VMDEIHTVLKKDNVKNEDKDQKSKENGASV                                           1121 - 1150
//

Text Mined References (47)

PMID Year Title
25894788 2015 CARP-1/CCAR1: a biphasic regulator of cancer cell growth and apoptosis.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25610865 2014 DBC1/CCAR2 and CCAR1 Are Largely Disordered Proteins that Have Evolved from One Common Ancestor.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24245781 2014 CCAR1/CoCoA pair-mediated recruitment of the Mediator defines a novel pathway for GATA1 function.
23975424 2013 Par-4/THAP1 complex and Notch3 competitively regulated pre-mRNA splicing of CCAR1 and affected inversely the survival of T-cell acute lymphoblastic leukemia cells.
More...