Property Summary

NCBI Gene PubMed Count 6
PubMed Score 56.58
PubTator Score 65.50

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
17699833 Sera from 20% of patients with occult hepatitis C infection react with the GOR autoepitope in enzyme immumoassays, although this frequency is lower than the GOR reactivity of patients with chronic hepatitis C.

AA Sequence

MLRATAPCWFPPGYPEAKKVAEEAALEASRHLGGEQSQAGAPEGSKMLRATAPCWFRPGYPEAKKVAKEA      1 - 70
APEASRHLGAEQSPAGAPEGSKMLRATAPCWFPPGYPEAKKVAEEAALEAPEFPLPSHQPAQSFGLWVPQ     71 - 140
MHKQASAFVDIQAEPQNRGPAVPPAWPKMVTESCYFPAQRGSACRLPAAPRLTERPSGVRISAPRKRKTI    141 - 210
AHSSSPCLVTGYTDAKRTRVASSSQRSRGSKVGRQPGKTRNRSGMACKTTATTSSKRIVRRASLPSLSLK    211 - 280
KPIILRSSGCQVPTVLRRGYLQLFTEECLKFCASKQEAEEKALNEEKVAYDCSPNKNRYLNVVLNTLKRL    281 - 350
KGLTPSSMPGLSRAALYSRLQEFLLTQDQLKENGYPFPHPERPGGAVLFTGQGKGPGDSSCRVCCRCGTE    351 - 420
YLVSSSGRCVRDQLCYYHWGRVRSSQVAGGRVSQYTCCAAAPGSVGCQVAKQHVRDGRKESLDGFVETFK    421 - 490
KELSRDAYPGIYALDCEMCYTTHGLELTRVTVVDADMRVVYDTFVKPDNEIVDYNTRFSGVTEADVAKTS    491 - 560
ITLPQVQAILLSFFSAQTILIGHSLESDLLALKLIHSTVVDTAVLFPHYLGFPYKRSLRNLAADYLAQII    561 - 630
QDSQDGHNSSEDASACLQLVMWKVRQRAQIQPRHRSASPAALACP                             631 - 675
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
17699833 2007 Serum immunoglobulin G antibodies to the GOR autoepitope are present in patients with occult hepatitis C virus (HCV) infection despite lack of HCV-specific antibodies.
16421571 2006 DNA sequence and analysis of human chromosome 8.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11472404 2001 The GOR gene product cannot cross-react with hepatitis C virus in humans.
9846365 1998 The GOR47-1 sequence in human DNA encoding for a potential autoantigen in connection with hepatitis C--a sequence not only reserved for humans.
1701012 1990 Non-A, non-B hepatitis specific antibodies directed at host-derived epitope: implication for an autoimmune process.