Property Summary

NCBI Gene PubMed Count 14
PubMed Score 43.91
PubTator Score 20.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
adrenocortical carcinoma -1.864 7.6e-05
astrocytoma 1.500 4.9e-02
Astrocytoma, Pilocytic 1.400 4.5e-06
Atopic dermatitis -1.400 1.7e-03
atypical teratoid / rhabdoid tumor -1.300 1.5e-02
autosomal dominant Emery-Dreifuss muscul... 1.479 2.1e-03
Breast cancer -1.400 1.6e-04
breast carcinoma -1.300 1.6e-04
chronic lymphosyte leukemia -1.600 3.6e-10
colon cancer -1.200 1.9e-02
Down syndrome 1.300 2.9e-03
Duchenne muscular dystrophy 1.542 1.8e-07
ductal carcinoma in situ -1.300 6.2e-04
fibroadenoma -1.100 4.1e-02
glioblastoma 2.000 2.2e-03
group 4 medulloblastoma -2.100 2.0e-05
intraductal papillary-mucinous adenoma (... -1.700 2.5e-02
intraductal papillary-mucinous carcinoma... -2.200 2.3e-02
intraductal papillary-mucinous neoplasm ... -2.400 2.4e-02
invasive ductal carcinoma -2.100 8.6e-05
lung adenocarcinoma -1.100 5.8e-05
lung cancer -2.100 1.4e-03
malignant mesothelioma 1.100 4.3e-05
medulloblastoma, large-cell -1.800 6.9e-06
non-small cell lung cancer -2.481 3.0e-28
ovarian cancer -4.000 3.2e-13
pancreatic ductal adenocarcinoma liver m... -2.920 5.2e-03
psoriasis -1.200 2.2e-04
tuberculosis 1.900 3.3e-06

Gene RIF (7)

AA Sequence

MLRAALPALLLPLLGLAAAAVADCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEE      1 - 70
ENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDDEDLVDTCAFLHIKTGEWKK     71 - 140
GNCEVSSVEGTLCKTAIPYKRKYLSDNHILISALVIASTVILTVLGAIIWFLYKKHSDSRFTTVFSTAPQ    141 - 210
SPYNEDCVLVVGEENEYPVQFD                                                    211 - 232
//

Text Mined References (16)

PMID Year Title