Property Summary

NCBI Gene PubMed Count 13
Grant Count 1
Funding $14,189.2
PubMed Score 46.51
PubTator Score 20.51

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8IX05 A8K5G4 B4E2T9 Q15009
Symbols DCL1
DCL-1
BIMLEC
CLEC13A

Gene

 Grant Application (1)

Gene RIF (6)

PMID Text
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of CD302 (DCL1) in peptide-treated PBMCs
20861185 Decreased DCL1 is associated with angiogenesis in prostate cancer.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19317456 DCL1 equilibrium unfolding is characterized at the amino acid level.
17947679 hDCL-1 is an unconventional lectin receptor that plays roles not only in endocytosis/phagocytosis but also in cell adhesion and migration
12824192 Hodgkin's lymphoma cell lines express a fusion protein encoded by intergenically spliced mRNA for the multilectin receptor DEC-205 (CD205) and a novel C-type lectin receptor DCL-1

AA Sequence

MLRAALPALLLPLLGLAAAAVADCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEE      1 - 70
ENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDDEDLVDTCAFLHIKTGEWKK     71 - 140
GNCEVSSVEGTLCKTAIPYKRKYLSDNHILISALVIASTVILTVLGAIIWFLYKKHSDSRFTTVFSTAPQ    141 - 210
SPYNEDCVLVVGEENEYPVQFD                                                    211 - 232
//

Text Mined References (14)

PMID Year Title
20861185 2010 DLC1 negatively regulates angiogenesis in a paracrine fashion.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19946888 2010 Defining the membrane proteome of NK cells.
19317456 2009 Characterization of DLC1-SAM equilibrium unfolding at the amino acid residue level.
17947679 2007 The novel endocytic and phagocytic C-Type lectin receptor DCL-1/CD302 on macrophages is colocalized with F-actin, suggesting a role in cell adhesion and migration.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12824192 2003 Hodgkin's lymphoma cell lines express a fusion protein encoded by intergenically spliced mRNA for the multilectin receptor DEC-205 (CD205) and a novel C-type lectin receptor DCL-1.
More...