Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.05
PubTator Score 71.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 1.6e-06
atypical teratoid / rhabdoid tumor 1.400 2.0e-05
ependymoma 1.700 9.1e-08
glioblastoma 1.500 2.8e-03
group 4 medulloblastoma 1.200 3.9e-03
osteosarcoma 1.251 6.6e-04
pediatric high grade glioma 1.100 5.6e-03
progressive supranuclear palsy -1.300 1.7e-02
psoriasis 1.600 8.4e-05
tuberculosis and treatment for 6 months -1.200 5.5e-03

Synonym

Accession Q8IX04 B2RB69 B4DL43 F5H6L6 H7BYD6 Q6P2F0 Q96FF5 Q9NUX7 UEV-3
Symbols ATTP
UEV3

Gene

PANTHER Protein Class (2)

PDB

2I6T   3DL2  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MEFDCEGLRRLLGKYKFRDLTVEELRNVNVFFPHFKYSMDTYVFKDSSQKDLLNFTGTIPVMYQGNTYNI      1 - 70
PIRFWILDSHPFAPPICFLKPTANMGILVGKHVDAQGRIYLPYLQNWSHPKSVIVGLIKEMIAKFQEELP     71 - 140
MYSLSSSDEARQVDLLAYIAKITEGVSDTNSKSWANHENKTVNKITVVGGGELGIACTLAISAKGIADRL    141 - 210
VLLDLSEGTKGATMDLEIFNLPNVEISKDLSASAHSKVVIFTVNSLGSSQSYLDVVQSNVDMFRALVPAL    211 - 280
GHYSQHSVLLVASQPVEIMTYVTWKLSTFPANRVIGIGCNLDSQRLQYIITNVLKAQTSGKEVWVIGEQG    281 - 350
EDKVLTWSGQEEVVSHTSQVQLSNRAMELLRVKGQRSWSVGLSVADMVDSIVNNKKKVHSVSALAKGYYD    351 - 420
INSEVFLSLPCILGTNGVSEVIKTTLKEDTVTEKLQSSASSIHSLQQQLKL                       421 - 471
//

Text Mined References (12)

PMID Year Title