Property Summary

NCBI Gene PubMed Count 9
Grant Count 51
R01 Count 32
Funding $13,225,193.03
PubMed Score 0.85
PubTator Score 71.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis 1.600 0.000
osteosarcoma 3.038 0.000
ependymoma 1.700 0.000
atypical teratoid / rhabdoid tumor 1.400 0.000
glioblastoma 1.500 0.003
tuberculosis and treatment for 6 months -1.200 0.006
pediatric high grade glioma 1.200 0.000
group 4 medulloblastoma 1.200 0.004
pilocytic astrocytoma 1.100 0.000
progressive supranuclear palsy -1.300 0.017

Gene RIF (1)

PMID Text
12427560 identification, sequencing and analysis of cDNA in various colon carcinoma cell lines as well as normal and tumor samples from colon

AA Sequence

MEFDCEGLRRLLGKYKFRDLTVEELRNVNVFFPHFKYSMDTYVFKDSSQKDLLNFTGTIPVMYQGNTYNI      1 - 70
PIRFWILDSHPFAPPICFLKPTANMGILVGKHVDAQGRIYLPYLQNWSHPKSVIVGLIKEMIAKFQEELP     71 - 140
MYSLSSSDEARQVDLLAYIAKITEGVSDTNSKSWANHENKTVNKITVVGGGELGIACTLAISAKGIADRL    141 - 210
VLLDLSEGTKGATMDLEIFNLPNVEISKDLSASAHSKVVIFTVNSLGSSQSYLDVVQSNVDMFRALVPAL    211 - 280
GHYSQHSVLLVASQPVEIMTYVTWKLSTFPANRVIGIGCNLDSQRLQYIITNVLKAQTSGKEVWVIGEQG    281 - 350
EDKVLTWSGQEEVVSHTSQVQLSNRAMELLRVKGQRSWSVGLSVADMVDSIVNNKKKVHSVSALAKGYYD    351 - 420
INSEVFLSLPCILGTNGVSEVIKTTLKEDTVTEKLQSSASSIHSLQQQLKL                       421 - 471
//

Text Mined References (12)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12427560 2002 Identification and characterization of UEV3, a human cDNA with similarities to inactive E2 ubiquitin-conjugating enzymes.
More...