Property Summary

NCBI Gene PubMed Count 71
Grant Count 15
R01 Count 9
Funding $1,995,982.33
PubMed Score 84.42
PubTator Score 97.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
nephrosclerosis -1.153 0.009
posterior fossa group A ependymoma 1.700 0.000
psoriasis -1.500 0.000
osteosarcoma 1.073 0.000
glioblastoma -1.700 0.006
medulloblastoma -2.600 0.000
atypical teratoid/rhabdoid tumor 1.900 0.000
medulloblastoma, large-cell -2.000 0.000
primitive neuroectodermal tumor -1.300 0.010
primary pancreatic ductal adenocarcinoma -1.412 0.007
colon cancer 2.100 0.001
interstitial cystitis -2.300 0.000
adult high grade glioma -1.500 0.001
pilocytic astrocytoma -1.100 0.001
spina bifida -2.271 0.036
Breast cancer -1.300 0.000
ovarian cancer 2.400 0.000
pancreatic cancer -1.100 0.038

Gene RIF (71)

PMID Text
26929199 Phosphorylation-dependent regulation of the DNA damage response of Kibra protein in cancer cells
26768155 decreased expression of the KIBRA gene on both mRNA and protein levels in depression, is reported.
26415670 Study did not find support for an association of KIBRA either alone or in combination with CLSTN2 with memory performance or hippocampal volume, nor did variation in these genes influence longitudinal memory decline or hippocampal atrophy in older adults
26156558 Study observed a trend for a better memory performance and significantly higher volumes and better microstructural integrity in the subfields comprising the CA2/3 and CA4/DG of the hippocampus in KIBRA T-allele carriers compared with non-T-carriers
25800888 KIBRA rs17070145 affects specific phenotypes (high alcohol consumption, APOE synergism) of Japanese patients with Alzheimer disease in an age-dependent manner. Right inferior frontal gyrus hyperperfusion was seen in the C allele carrier group.
25656173 In brief, we showed that individuals with MD[major depression] that were WWC1 rs17070145TT carriers reported more severe 'concentration difficulties' than C-carriers.
25146696 the study demonstrates an association between the KIBRA gene and episodic memory (immediate free recall) and suggests a differential effect of this genetic variant in early-onset schizophrenia and healthy siblings
25080189 The results of this study supports the view that effects of KIBRA and CLSTN2 polymorphisms genetic polymorphisms on cognitive functioning may be most easily disclosed at suboptimal levels of cognitive ability, such as in old-age depression.
25023289 overexpression of Kibra rescues the increased cell migration and aberrant three-dimensional morphogenesis induced by knockdown of PTPN14, and this rescue is mediated through the activation of the upstream LATS1 kinase
24642126 KIBRA is involved in human tumorigenesis and other physiological processes including cell polarity, membrane/vesicular trafficking, mitosis and cell migration.
More...

AA Sequence

MPRPELPLPEGWEEARDFDGKVYYIDHTNRTTSWIDPRDRYTKPLTFADCISDELPLGWEEAYDPQVGDY      1 - 70
FIDHNTKTTQIEDPRVQWRREQEHMLKDYLVVAQEALSAQKEIYQVKQQRLELAQQEYQQLHAVWEHKLG     71 - 140
SQVSLVSGSSSSSKYDPEILKAEIATAKSRVNKLKREMVHLQHELQFKERGFQTLKKIDKKMSDAQGSYK    141 - 210
LDEAQAVLRETKAIKKAITCGEKEKQDLIKSLAMLKDGFRTDRGSHSDLWSSSSSLESSSFPLPKQYLDV    211 - 280
SSQTDISGSFGINSNNQLAEKVRLRLRYEEAKRRIANLKIQLAKLDSEAWPGVLDSERDRLILINEKEEL    281 - 350
LKEMRFISPRKWTQGEVEQLEMARKRLEKDLQAARDTQSKALTERLKLNSKRNQLVRELEEATRQVATLH    351 - 420
SQLKSLSSSMQSLSSGSSPGSLTSSRGSLVASSLDSSTSASFTDLYYDPFEQLDSELQSKVEFLLLEGAT    421 - 490
GFRPSGCITTIHEDEVAKTQKAEGGGRLQALRSLSGTPKSMTSLSPRSSLSSPSPPCSPLMADPLLAGDA    491 - 560
FLNSLEFEDPELSATLCELSLGNSAQERYRLEEPGTEGKQLGQAVNTAQGCGLKVACVSAAVSDESVAGD    561 - 630
SGVYEASVQRLGASEAAAFDSDESEAVGATRIQIALKYDEKNKQFAILIIQLSNLSALLQQQDQKVNIRV    631 - 700
AVLPCSESTTCLFRTRPLDASDTLVFNEVFWVSMSYPALHQKTLRVDVCTTDRSHLEECLGGAQISLAEV    701 - 770
CRSGERSTRWYNLLSYKYLKKQSRELKPVGVMAPASGPASTDAVSALLEQTAVELEKRQEGRSSTQTLED    771 - 840
SWRYEETSENEAVAEEEEEEVEEEEGEEDVFTEKASPDMDGYPALKVDKETNTETPAPSPTVVRPKDRRV    841 - 910
GTPSQGPFLRGSTIIRSKTFSPGPQSQYVCRLNRSDSDSSTLSKKPPFVRNSLERRSVRMKRPSSVKSLR    911 - 980
SERLIRTSLDLELDLQATRTWHSQLTQEISVLKELKEQLEQAKSHGEKELPQWLREDERFRLLLRMLEKR    981 - 1050
QMDRAEHKGELQTDKMMRAAAKDVHRLRGQSCKEPPEVQSFREKMAFFTRPRMNIPALSADDV          1051 - 1113
//

Text Mined References (78)

PMID Year Title
26929199 2016 Phosphorylation-Dependent Regulation of the DNA Damage Response of Adaptor Protein KIBRA in Cancer Cells.
26768155 2016 Serum KIBRA mRNA and Protein Expression and Cognitive Functions in Depression.
26415670 2015 Investigating the influence of KIBRA and CLSTN2 genetic polymorphisms on cross-sectional and longitudinal measures of memory performance and hippocampal volume in older individuals.
26156558 2016 Impact of KIBRA Polymorphism on Memory Function and the Hippocampus in Older Adults.
25800888 2015 Genetic Association Between KIBRA Polymorphism and Alzheimer's Disease with in a Japanese Population.
25656173 2015 KIBRA genetic polymorphism and cognitive dysfunction in depression.
25146696 2014 Association of KIBRA rs17070145 polymorphism with episodic memory in the early stages of a human neurodevelopmental disorder.
25080189 2014 Interactive effects of KIBRA and CLSTN2 polymorphisms on episodic memory in old-age unipolar depression.
25023289 2014 PTPN14 forms a complex with Kibra and LATS1 proteins and negatively regulates the YAP oncogenic function.
24682284 2014 Evolutionary and molecular facts link the WWC protein family to Hippo signaling.
More...