Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.80
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.200 2.0e-02
ependymoma 1.700 9.0e-04
glioblastoma -1.200 3.3e-05
intraductal papillary-mucinous carcinoma... 1.100 5.9e-03
lung cancer 1.200 1.3e-02
medulloblastoma, large-cell -1.200 7.9e-04
oligodendroglioma 1.600 7.9e-04
osteosarcoma -1.306 2.8e-06
ovarian cancer 1.600 1.5e-04
pancreatic ductal adenocarcinoma liver m... 1.641 1.0e-03
Pick disease -1.300 5.6e-06
psoriasis -1.600 6.4e-05

AA Sequence

MAARRITQETFDAVLQEKAKRYHMDASGEAVSETLQFKAQDLLRAVPRSRAEMYDDVHSDGRYSLSGSVA      1 - 70
HSRDAGREGLRSDVFPGPSFRSSNPSISDDSYFRKECGRDLEFSHSDSRDQVIGHRKLGHFRSQDWKFAL     71 - 140
RGSWEQDFGHPVSQESSWSQEYSFGPSAVLGDFGSSRLIEKECLEKESRDYDVDHPGEADSVLRGGSQVQ    141 - 210
ARGRALNIVDQEGSLLGKGETQGLLTAKGGVGKLVTLRNVSTKKIPTVNRITPKTQGTNQIQKNTPSPDV    211 - 280
TLGTNPGTEDIQFPIQKIPLGLDLKNLRLPRRKMSFDIIDKSDVFSRFGIEIIKWAGFHTIKDDIKFSQL    281 - 350
FQTLFELETETCAKMLASFKCSLKPEHRDFCFFTIKFLKHSALKTPRVDNEFLNMLLDKGAVKTKNCFFE    351 - 420
IIKPFDKYIMRLQDRLLKSVTPLLMACNAYELSVKMKTLSNPLDLALALETTNSLCRKSLALLGQTFSLA    421 - 490
SSFRQEKILEAVGLQDIAPSPAAFPNFEDSTLFGREYIDHLKAWLVSSGCPLQVKKAEPEPMREEEKMIP    491 - 560
PTKPEIQAKAPSSLSDAVPQRADHRVVGTIDQLVKRVIEGSLSPKERTLLKEDPAYWFLSDENSLEYKYY    561 - 630
KLKLAEMQRMSENLRGADQKPTSADCAVRAMLYSRAVRNLKKKLLPWQRRGLLRAQGLRGWKARRATTGT    631 - 700
QTLLSSGTRLKHHGRQAPGLSQAKPSLPDRNDAAKDCPPDPVGPSPQDPSLEASGPSPKPAGVDISEAPQ    701 - 770
TSSPCPSADIDMKTMETAEKLARFVAQVGPEIEQFSIENSTDNPDLWFLHDQNSSAFKFYRKKVFELCPS    771 - 840
ICFTSSPHNLHTGGGDTTGSQESPVDLMEGEAEFEDEPPPREAELESPEVMPEEEDEDDEDGGEEAPAPG    841 - 910
GAGKSEGSTPADGLPGEAAEDDLAGAPALSQASSGTCFPRKRISSKSLKVGMIPAPKRVCLIQEPKVHEP    911 - 980
VRIAYDRPRGRPMSKKKKPKDLDFAQQKLTDKNLGFQMLQKMGWKEGHGLGSLGKGIREPVSVGTPSEGE    981 - 1050
GLGADGQEHKEDTFDVFRQRMMQMYRHKRANK                                         1051 - 1082
//

Text Mined References (24)

PMID Year Title