Property Summary

NCBI Gene PubMed Count 19
PubMed Score 24.95
PubTator Score 24.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.555 0.002
lung adenocarcinoma -2.400 0.000
atypical teratoid/rhabdoid tumor 1.200 0.023
lung carcinoma -1.200 0.000
non-small cell lung carcinoma -1.100 0.000
ovarian cancer -1.100 0.000
pituitary cancer -1.200 0.000
psoriasis -2.100 0.000

Synonym

Accession Q8IWY4 Q5R336
Symbols

Gene

Gene RIF (8)

PMID Text
26699903 describe novel mechanisms in targeting S1 to the plasma membrane and demonstrate that N-glycans are required for S1 functions during primitive haematopoiesis in zebrafish.
26438214 SCUBE1 may indicate hypercoagulability in patients with BC and thus help identify patients at greater risk of thrombosisSCUBE1 may indicate hypercoagulability in patients with breast cancer and thus help identify patients at greater risk of thrombosis
23632301 SCUBE1 levels are a new biomarker that can be used in the differential diagnosis and monitoring of patients hospitalized with suspected CCHF.
23220851 SCUBE 1 levels in patients with gastric cancer were found higher compared to healthy subjects.
23136397 Primary prostatic cancer-associated fibroblasts (CAFs) were isolated and the expression of CAF markers, Dlk1 and SCUBE1 transcripts were characterised.
22874483 SCUBE1 level, a potential acute ischemia marker, is elevated in hemodialysis patients with no clinical ischemic event.
20962850 Observational study of gene-disease association. (HuGE Navigator)
12270931 identification as secreted protein that is expressed in vascular endothelium and may play important roles in development, inflammation, and thrombosis

AA Sequence

MGAAAVRWHLCVLLALGTRGRLAGGSGLPGSVDVDECSEGTDDCHIDAICQNTPKSYKCLCKPGYKGEGK      1 - 70
QCEDIDECENDYYNGGCVHECINIPGNYRCTCFDGFMLAHDGHNCLDVDECQDNNGGCQQICVNAMGSYE     71 - 140
CQCHSGFFLSDNQHTCIHRSNEGMNCMNKDHGCAHICRETPKGGVACDCRPGFDLAQNQKDCTLTCNYGN    141 - 210
GGCQHSCEDTDTGPTCGCHQKYALHSDGRTCIETCAVNNGGCDRTCKDTATGVRCSCPVGFTLQPDGKTC    211 - 280
KDINECLVNNGGCDHFCRNTVGSFECGCRKGYKLLTDERTCQDIDECSFERTCDHICINSPGSFQCLCHR    281 - 350
GYILYGTTHCGDVDECSMSNGSCDQGCVNTKGSYECVCPPGRRLHWNGKDCVETGKCLSRAKTSPRAQLS    351 - 420
CSKAGGVESCFLSCPAHTLFVPDSENSYVLSCGVPGPQGKALQKRNGTSSGLGPSCSDAPTTPIKQKARF    421 - 490
KIRDAKCHLRPHSQARAKETARQPLLDHCHVTFVTLKCDSSKKRRRGRKSPSKEVSHITAEFEIETKMEE    491 - 560
ASDTCEADCLRKRAEQSLQAAIKTLRKSIGRQQFYVQVSGTEYEVAQRPAKALEGQGACGAGQVLQDSKC    561 - 630
VACGPGTHFGGELGQCVSCMPGTYQDMEGQLSCTPCPSSDGLGLPGARNVSECGGQCSPGFFSADGFKPC    631 - 700
QACPVGTYQPEPGRTGCFPCGGGLLTKHEGTTSFQDCEAKVHCSPGHHYNTTTHRCIRCPVGTYQPEFGQ    701 - 770
NHCITCPGNTSTDFDGSTNVTHCKNQHCGGELGDYTGYIESPNYPGDYPANAECVWHIAPPPKRRILIVV    771 - 840
PEIFLPIEDECGDVLVMRKSASPTSITTYETCQTYERPIAFTSRSRKLWIQFKSNEGNSGKGFQVPYVTY    841 - 910
DEDYQQLIEDIVRDGRLYASENHQEILKDKKLIKALFDVLAHPQNYFKYTAQESKEMFPRSFIKLLRSKV    911 - 980
SRFLRPYK                                                                  981 - 988
//

Text Mined References (20)

PMID Year Title
26699903 2016 Electrostatics and N-glycan-mediated membrane tethering of SCUBE1 is critical for promoting bone morphogenetic protein signalling.
26438214 2015 Elevated Serum Levels of SCUBE1, a Marker for Coagulation, in Patients with Breast Cancer.
23918034 2014 Genome-wide association study (GWAS) for molar-incisor hypomineralization (MIH).
23632301 2013 The diagnostic and prognostic significance of SCUBE1 levels in Crimean-Congo hemorrhagic fever.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23220851 2012 Is SCUBE 1 a new biomarker for gastric cancer?
23149075 2013 Preliminary evidence of genetic determinants of adiponectin response to fenofibrate in the Genetics of Lipid Lowering Drugs and Diet Network.
23136397 2013 Reduction of pro-tumorigenic activity of human prostate cancer-associated fibroblasts using Dlk1 or SCUBE1.
22874483 2012 Signal peptide-CUB-EGF domain-containing protein 1 (SCUBE1) level in hemodialysis patients and parameters affecting that level.
20962850 2011 A targeted association study in systemic lupus erythematosus identifies multiple susceptibility alleles.
More...