Property Summary

NCBI Gene PubMed Count 23
PubMed Score 28.24
PubTator Score 24.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Systemic lupus erythematosus 194 0.0 2.6
Disease Target Count Z-score Confidence
Spermatic cord torsion 12 3.747 1.9

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.200 2.3e-02
lung adenocarcinoma -1.100 7.0e-16
lung carcinoma -1.200 4.2e-13
non-small cell lung carcinoma -1.100 2.6e-36
osteosarcoma -1.555 1.6e-03
ovarian cancer -1.100 4.9e-04
pituitary cancer -1.200 6.5e-05
psoriasis -2.100 2.5e-51

Gene RIF (12)

AA Sequence

MGAAAVRWHLCVLLALGTRGRLAGGSGLPGSVDVDECSEGTDDCHIDAICQNTPKSYKCLCKPGYKGEGK      1 - 70
QCEDIDECENDYYNGGCVHECINIPGNYRCTCFDGFMLAHDGHNCLDVDECQDNNGGCQQICVNAMGSYE     71 - 140
CQCHSGFFLSDNQHTCIHRSNEGMNCMNKDHGCAHICRETPKGGVACDCRPGFDLAQNQKDCTLTCNYGN    141 - 210
GGCQHSCEDTDTGPTCGCHQKYALHSDGRTCIETCAVNNGGCDRTCKDTATGVRCSCPVGFTLQPDGKTC    211 - 280
KDINECLVNNGGCDHFCRNTVGSFECGCRKGYKLLTDERTCQDIDECSFERTCDHICINSPGSFQCLCHR    281 - 350
GYILYGTTHCGDVDECSMSNGSCDQGCVNTKGSYECVCPPGRRLHWNGKDCVETGKCLSRAKTSPRAQLS    351 - 420
CSKAGGVESCFLSCPAHTLFVPDSENSYVLSCGVPGPQGKALQKRNGTSSGLGPSCSDAPTTPIKQKARF    421 - 490
KIRDAKCHLRPHSQARAKETARQPLLDHCHVTFVTLKCDSSKKRRRGRKSPSKEVSHITAEFEIETKMEE    491 - 560
ASDTCEADCLRKRAEQSLQAAIKTLRKSIGRQQFYVQVSGTEYEVAQRPAKALEGQGACGAGQVLQDSKC    561 - 630
VACGPGTHFGGELGQCVSCMPGTYQDMEGQLSCTPCPSSDGLGLPGARNVSECGGQCSPGFFSADGFKPC    631 - 700
QACPVGTYQPEPGRTGCFPCGGGLLTKHEGTTSFQDCEAKVHCSPGHHYNTTTHRCIRCPVGTYQPEFGQ    701 - 770
NHCITCPGNTSTDFDGSTNVTHCKNQHCGGELGDYTGYIESPNYPGDYPANAECVWHIAPPPKRRILIVV    771 - 840
PEIFLPIEDECGDVLVMRKSASPTSITTYETCQTYERPIAFTSRSRKLWIQFKSNEGNSGKGFQVPYVTY    841 - 910
DEDYQQLIEDIVRDGRLYASENHQEILKDKKLIKALFDVLAHPQNYFKYTAQESKEMFPRSFIKLLRSKV    911 - 980
SRFLRPYK                                                                  981 - 988
//

Text Mined References (24)

PMID Year Title