Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.15
PubTator Score 5.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
adult high grade glioma -2.600 1.3e-07
astrocytic glioma -2.100 1.3e-03
Astrocytoma, Pilocytic -2.200 4.2e-08
atypical teratoid/rhabdoid tumor -1.100 2.5e-02
ductal carcinoma in situ 1.900 6.0e-03
Endometriosis -1.608 2.9e-02
ependymoma -1.100 3.6e-03
glioblastoma -2.100 2.6e-08
group 3 medulloblastoma -1.800 1.3e-03
interstitial cystitis -1.300 1.1e-02
intraductal papillary-mucinous adenoma (... 1.400 3.3e-02
intraductal papillary-mucinous carcinoma... 2.200 6.0e-03
intraductal papillary-mucinous neoplasm ... 2.500 8.5e-03
invasive ductal carcinoma 3.000 1.1e-02
lung adenocarcinoma 1.300 4.0e-07
medulloblastoma, large-cell -1.800 2.0e-02
non-small cell lung cancer 1.021 3.9e-04
oligodendroglioma -1.600 1.1e-02
osteosarcoma -1.061 3.6e-04
ovarian cancer -1.100 2.2e-03
pancreatic cancer 1.800 1.9e-06
Pick disease 1.300 2.5e-03
primary pancreatic ductal adenocarcinoma 2.502 1.0e-04
primitive neuroectodermal tumor -2.100 7.5e-04
spina bifida -1.472 2.8e-02
subependymal giant cell astrocytoma -2.677 8.2e-03
tuberculosis -2.200 2.7e-05
urothelial carcinoma -2.200 1.6e-02

 GWAS Trait (1)

Gene RIF (3)

AA Sequence

MAELLRSLQDSQLVARFQRRCGLFPAPDEGPRENGADPTERAARVPGVEHLPAANGKGGEAPANGLRRAA      1 - 70
APEAYVQKYVVKNYFYYYLFQFSAALGQEVFYITFLPFTHWNIDPYLSRRLIIIWVLVMYIGQVAKDVLK     71 - 140
WPRPSSPPVVKLEKRLIAEYGMPSTHAMAATAIAFTLLISTMDRYQYPFVLGLVMAVVFSTLVCLSRLYT    141 - 210
GMHTVLDVLGGVLITALLIVLTYPAWTFIDCLDSASPLFPVCVIVVPFFLCYNYPVSDYYSPTRADTTTI    211 - 280
LAAGAGVTIGFWINHFFQLVSKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVL    281 - 350
YSWFKVVTRNKEARRRLEIEVPYKFVTYTSVGICATTFVPMLHRFLGLP                         351 - 399
//

Text Mined References (10)

PMID Year Title