Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.96
PubTator Score 5.88

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8IWX5 A3KPB4 Q8N8Q6 SPPase2
Symbols SPP2
SPPase2

Gene

PANTHER Protein Class (2)

Gene RIF (3)

PMID Text
24274704 SGPP2, a sphingosine-1-phosphate phosphatase, is a novel vitamin D-responsive gene associated with lung function.
17113265 This study provides detailed insights into the regulation of SPP2 gene expression and suggests that SPP2 might be a novel player in pro-inflammatory signalling.
12411432 characterization of SPP2, another member of the SPP family that may play a role in attenuating intracellular S1P signaling.

AA Sequence

MAELLRSLQDSQLVARFQRRCGLFPAPDEGPRENGADPTERAARVPGVEHLPAANGKGGEAPANGLRRAA      1 - 70
APEAYVQKYVVKNYFYYYLFQFSAALGQEVFYITFLPFTHWNIDPYLSRRLIIIWVLVMYIGQVAKDVLK     71 - 140
WPRPSSPPVVKLEKRLIAEYGMPSTHAMAATAIAFTLLISTMDRYQYPFVLGLVMAVVFSTLVCLSRLYT    141 - 210
GMHTVLDVLGGVLITALLIVLTYPAWTFIDCLDSASPLFPVCVIVVPFFLCYNYPVSDYYSPTRADTTTI    211 - 280
LAAGAGVTIGFWINHFFQLVSKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVL    281 - 350
YSWFKVVTRNKEARRRLEIEVPYKFVTYTSVGICATTFVPMLHRFLGLP                         351 - 399
//

Text Mined References (10)

PMID Year Title
26494556 2015 Tumor suppressor microRNA-31 inhibits gastric carcinogenesis by targeting Smad4 and SGPP2.
24274704 2013 Vitamin D-responsive SGPP2 variants associated with lung cell expression and lung function.
23568457 2013 Genetic variants associated with disordered eating.
22277765 2012 Sphingosine pathway deregulation in endometriotic tissues.
17113265 2007 Sphingosine 1-phosphate phosphatase 2 is induced during inflammatory responses.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12411432 2003 Identification and characterization of a novel human sphingosine-1-phosphate phosphohydrolase, hSPP2.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.