Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.96
PubTator Score 5.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 2.69648315819162E-11
medulloblastoma 1524 3.04477392529303E-8
pilocytic astrocytoma 3086 3.87446068795045E-8
adult high grade glioma 2148 1.32523227995113E-7
pancreatic cancer 2300 1.53043868165157E-7
lung adenocarcinoma 2714 3.98881738977351E-7
tuberculosis 1563 2.72296976944579E-5
interstitial cystitis 2299 2.83499188164864E-5
glioblastoma 5572 3.69571449241033E-5
urothelial carcinoma 318 4.957043162398E-5
primary pancreatic ductal adenocarcinoma 1271 9.97233324090987E-5
osteosarcoma 7933 3.59665514419958E-4
primitive neuroectodermal tumor 3031 7.48311483440964E-4
astrocytic glioma 2241 0.00127619687460296
ovarian cancer 8492 0.00215352956325264
Pick disease 1893 0.00245272548506821
ependymoma 2514 0.00359556103898187
ductal carcinoma in situ 1745 0.00598516100327343
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00600858112593836
subependymal giant cell astrocytoma 2287 0.00820519679384845
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00850914474904122
oligodendroglioma 2849 0.0107364472142495
invasive ductal carcinoma 2950 0.0114248361576991
medulloblastoma, large-cell 6234 0.0204719720262939
atypical teratoid/rhabdoid tumor 1095 0.0246807822716138
spina bifida 1064 0.0277788002127493
intraductal papillary-mucinous adenoma (IPMA) 2956 0.033120958476907
Endometriosis 535 0.0450157775004585

Expression

Synonym

Accession Q8IWX5 A3KPB4 Q8N8Q6 SPPase2
Symbols SPP2
SPPase2

Gene

PANTHER Protein Class (2)

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG

 GWAS Trait (1)

Gene RIF (3)

PMID Text
24274704 SGPP2, a sphingosine-1-phosphate phosphatase, is a novel vitamin D-responsive gene associated with lung function.
17113265 This study provides detailed insights into the regulation of SPP2 gene expression and suggests that SPP2 might be a novel player in pro-inflammatory signalling.
12411432 characterization of SPP2, another member of the SPP family that may play a role in attenuating intracellular S1P signaling.

AA Sequence

MAELLRSLQDSQLVARFQRRCGLFPAPDEGPRENGADPTERAARVPGVEHLPAANGKGGEAPANGLRRAA      1 - 70
APEAYVQKYVVKNYFYYYLFQFSAALGQEVFYITFLPFTHWNIDPYLSRRLIIIWVLVMYIGQVAKDVLK     71 - 140
WPRPSSPPVVKLEKRLIAEYGMPSTHAMAATAIAFTLLISTMDRYQYPFVLGLVMAVVFSTLVCLSRLYT    141 - 210
GMHTVLDVLGGVLITALLIVLTYPAWTFIDCLDSASPLFPVCVIVVPFFLCYNYPVSDYYSPTRADTTTI    211 - 280
LAAGAGVTIGFWINHFFQLVSKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVL    281 - 350
YSWFKVVTRNKEARRRLEIEVPYKFVTYTSVGICATTFVPMLHRFLGLP                         351 - 399
//

Text Mined References (10)

PMID Year Title
26494556 2015 Tumor suppressor microRNA-31 inhibits gastric carcinogenesis by targeting Smad4 and SGPP2.
24274704 2013 Vitamin D-responsive SGPP2 variants associated with lung cell expression and lung function.
23568457 2013 Genetic variants associated with disordered eating.
22277765 2012 Sphingosine pathway deregulation in endometriotic tissues.
17113265 2007 Sphingosine 1-phosphate phosphatase 2 is induced during inflammatory responses.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12411432 2003 Identification and characterization of a novel human sphingosine-1-phosphate phosphohydrolase, hSPP2.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.