Property Summary

NCBI Gene PubMed Count 12
PubMed Score 23.42
PubTator Score 57.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.528 0.001
group 3 medulloblastoma -1.600 0.000
medulloblastoma, large-cell -1.300 0.001
non-small cell lung cancer -1.143 0.000
lung adenocarcinoma -1.100 0.000
gastric carcinoma -1.600 0.025
psoriasis -1.100 0.000

Synonym

Accession Q8IWW8 B4DTJ8 Q49A19 Q68CI7 Q6P2B6 Q96MF9 HOT
Symbols HOT
ADH8
HMFT2263

Gene

PANTHER Protein Class (2)

Gene RIF (5)

PMID Text
24886599 These results demonstrate that the promoter hypermethylation of ADHFE1 is frequently present in CRC and alcohol induces methylation-mediated down expression of ADHFE1 and proliferation of CRC cells.
23517143 ADHFE1 has an important role of differentiation in CRC, as well as normal colorectal mucosa and embryonic developmental processes.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19013439 show that the ADHFe1 gene is related to bacterial GHB dehydrogenases and has a conserved NAD-binding site
12592711 cloned and characterized an iron-activated alcohol dehydrogenase gene, Fe-containing alcohol dehydrogenase 1 (ADHFe1)

AA Sequence

MAAAARARVAYLLRQLQRAACQCPTHSHTYSQAPGLSPSGKTTDYAFEMAVSNIRYGAAVTKEVGMDLKN      1 - 70
MGAKNVCLMTDKNLSKLPPVQVAMDSLVKNGIPFTVYDNVRVEPTDSSFMEAIEFAQKGAFDAYVAVGGG     71 - 140
STMDTCKAANLYASSPHSDFLDYVSAPIGKGKPVSVPLKPLIAVPTTSGTGSETTGVAIFDYEHLKVKIG    141 - 210
ITSRAIKPTLGLIDPLHTLHMPARVVANSGFDVLCHALESYTTLPYHLRSPCPSNPITRPAYQGSNPISD    211 - 280
IWAIHALRIVAKYLKRAVRNPDDLEARSHMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKMYKAKDYNV    281 - 350
DHPLVPHGLSVVLTSPAVFTFTAQMFPERHLEMAEILGADTRTARIQDAGLVLADTLRKFLFDLDVDDGL    351 - 420
AAVGYSKADIPALVKGTLPQERVTKLAPCPQSEEDLAALFEASMKLY                           421 - 467
//

Text Mined References (15)

PMID Year Title
24886599 2014 Alcohol induces cell proliferation via hypermethylation of ADHFE1 in colorectal cancer cells.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23517143 2013 Alcohol dehydrogenase, iron containing, 1 promoter hypermethylation associated with colorectal cancer differentiation.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19013439 2009 Enzymes involved in the metabolism of gamma-hydroxybutyrate in SH-SY5Y cells: identification of an iron-dependent alcohol dehydrogenase ADHFe1.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16616524 2006 Identification of the gene encoding hydroxyacid-oxoacid transhydrogenase, an enzyme that metabolizes 4-hydroxybutyrate.
16435184 2005 Kinetic characterization of human hydroxyacid-oxoacid transhydrogenase: relevance to D-2-hydroxyglutaric and gamma-hydroxybutyric acidurias.
More...