Property Summary

NCBI Gene PubMed Count 12
PubMed Score 25.44
PubTator Score 57.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
D-2-hydroxyglutaric aciduria 9 4.155 2.1

Expression

  Differential Expression (7)

Disease log2 FC p
gastric carcinoma -1.600 2.5e-02
group 3 medulloblastoma -1.600 7.3e-05
lung adenocarcinoma -1.100 1.1e-09
medulloblastoma, large-cell -1.300 8.1e-04
non-small cell lung cancer -1.143 9.8e-19
osteosarcoma -1.528 9.4e-04
psoriasis -1.100 7.3e-23

Gene RIF (5)

AA Sequence

MAAAARARVAYLLRQLQRAACQCPTHSHTYSQAPGLSPSGKTTDYAFEMAVSNIRYGAAVTKEVGMDLKN      1 - 70
MGAKNVCLMTDKNLSKLPPVQVAMDSLVKNGIPFTVYDNVRVEPTDSSFMEAIEFAQKGAFDAYVAVGGG     71 - 140
STMDTCKAANLYASSPHSDFLDYVSAPIGKGKPVSVPLKPLIAVPTTSGTGSETTGVAIFDYEHLKVKIG    141 - 210
ITSRAIKPTLGLIDPLHTLHMPARVVANSGFDVLCHALESYTTLPYHLRSPCPSNPITRPAYQGSNPISD    211 - 280
IWAIHALRIVAKYLKRAVRNPDDLEARSHMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKMYKAKDYNV    281 - 350
DHPLVPHGLSVVLTSPAVFTFTAQMFPERHLEMAEILGADTRTARIQDAGLVLADTLRKFLFDLDVDDGL    351 - 420
AAVGYSKADIPALVKGTLPQERVTKLAPCPQSEEDLAALFEASMKLY                           421 - 467
//

Text Mined References (15)

PMID Year Title