Property Summary

NCBI Gene PubMed Count 49
PubMed Score 35.57
PubTator Score 46.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.8
Skin cancer 469 0.0 0.6
Disease Target Count Z-score Confidence
Autism spectrum disorder 101 0.0 5.0
Disease Target Count
3p- syndrome 21

Expression

  Differential Expression (21)

Disease log2 FC p
active Crohn's disease -4.057 2.0e-04
active ulcerative colitis -4.190 1.2e-04
adult high grade glioma -3.900 3.9e-08
astrocytic glioma -3.200 1.2e-03
Astrocytoma, Pilocytic -3.800 5.2e-10
atypical teratoid / rhabdoid tumor -3.900 8.5e-07
Breast cancer -2.100 8.8e-08
ductal carcinoma in situ -1.200 5.0e-02
ependymoma -3.100 2.4e-03
glioblastoma -3.400 1.4e-09
group 3 medulloblastoma -1.900 2.1e-03
intraductal papillary-mucinous adenoma (... -2.400 1.6e-03
intraductal papillary-mucinous carcinoma... -2.500 2.2e-03
intraductal papillary-mucinous neoplasm ... -3.000 6.2e-03
lung adenocarcinoma -1.200 1.1e-12
medulloblastoma, large-cell -3.200 4.5e-04
oligodendroglioma -2.300 5.3e-03
osteosarcoma 1.750 2.3e-02
ovarian cancer -3.100 6.8e-13
primitive neuroectodermal tumor -3.100 8.0e-03
psoriasis -1.500 2.1e-39

 MGI Phenotype (1)

Gene RIF (19)

AA Sequence

MRLPWELLVLQSFILCLADDSTLHGPIFIQEPSPVMFPLDSEEKKVKLNCEVKGNPKPHIRWKLNGTDVD      1 - 70
TGMDFRYSVVEGSLLINNPNKTQDAGTYQCTATNSFGTIVSREAKLQFAYLDNFKTRTRSTVSVRRGQGM     71 - 140
VLLCGPPPHSGELSYAWIFNEYPSYQDNRRFVSQETGNLYIAKVEKSDVGNYTCVVTNTVTNHKVLGPPT    141 - 210
PLILRNDGVMGEYEPKIEVQFPETVPTAKGATVKLECFALGNPVPTIIWRRADGKPIARKARRHKSNGIL    211 - 280
EIPNFQQEDAGLYECVAENSRGKNVARGQLTFYAQPNWIQKINDIHVAMEENVFWECKANGRPKPTYKWL    281 - 350
KNGEPLLTRDRIQIEQGTLNITIVNLSDAGMYQCLAENKHGVIFSNAELSVIAVGPDFSRTLLKRVTLVK    351 - 420
VGGEVVIECKPKASPKPVYTWKKGRDILKENERITISEDGNLRIINVTKSDAGSYTCIATNHFGTASSTG    421 - 490
NLVVKDPTRVMVPPSSMDVTVGESIVLPCQVTHDHSLDIVFTWSFNGHLIDFDRDGDHFERVGGQDSAGD    491 - 560
LMIRNIQLKHAGKYVCMVQTSVDRLSAAADLIVRGPPGPPEAVTIDEITDTTAQLSWRPGPDNHSPITMY    561 - 630
VIQARTPFSVGWQAVSTVPELIDGKTFTATVVGLNPWVEYEFRTVAANVIGIGEPSRPSEKRRTEEALPE    631 - 700
VTPANVSGGGGSKSELVITWETVPEELQNGRGFGYVVAFRPYGKMIWMLTVLASADASRYVFRNESVHPF    701 - 770
SPFEVKVGVFNNKGEGPFSPTTVVYSAEEEPTKPPASIFARSLSATDIEVFWASPLEKNRGRIQGYEVKY    771 - 840
WRHEDKEENARKIRTVGNQTSTKITNLKGSVLYHLAVKAYNSAGTGPSSATVNVTTRKPPPSQPPGNIIW    841 - 910
NSSDSKIILNWDQVKALDNESEVKGYKVLYRWNRQSSTSVIETNKTSVELSLPFDEDYIIEIKPFSDGGD    911 - 980
GSSSEQIRIPKISNAYARGSGASTSNACTLSAISTIMISLTARSSL                            981 - 1026
//

Text Mined References (53)

PMID Year Title