Property Summary

NCBI Gene PubMed Count 45
Grant Count 22
R01 Count 10
Funding $1,183,896.46
PubMed Score 32.73
PubTator Score 46.89

Knowledge Summary

Patent

No data available

Expression

Gene RIF (17)

PMID Text
27039371 SNPs in ITPR1 and CNTN4 are involved in the regulation of serum uric acid concentrations in Mexican Americans
26146898 By combining methylation and SNP data, CNTN4 was identified as a risk factor for regular alcohol use.
25959733 data reveal critical and novel roles for CNTN4/amyloid precursor protein in promoting target-specific axon arborization
24764060 We identified CNTN4 as a novel candidate gene for POAG.
22750301 these results suggest that rare copy number variations in CNTN4 may also influence autism susceptibility in Asian populations.
21308999 Using array comparative genome hybridization (CGH), we identified a maternally inherited approximately 535 kb deletion at 3p26.3 encompassing the 5' end of the contactin 4 gene (CNTN4) in a patient with autism.
21079607 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MRLPWELLVLQSFILCLADDSTLHGPIFIQEPSPVMFPLDSEEKKVKLNCEVKGNPKPHIRWKLNGTDVD      1 - 70
TGMDFRYSVVEGSLLINNPNKTQDAGTYQCTATNSFGTIVSREAKLQFAYLDNFKTRTRSTVSVRRGQGM     71 - 140
VLLCGPPPHSGELSYAWIFNEYPSYQDNRRFVSQETGNLYIAKVEKSDVGNYTCVVTNTVTNHKVLGPPT    141 - 210
PLILRNDGVMGEYEPKIEVQFPETVPTAKGATVKLECFALGNPVPTIIWRRADGKPIARKARRHKSNGIL    211 - 280
EIPNFQQEDAGLYECVAENSRGKNVARGQLTFYAQPNWIQKINDIHVAMEENVFWECKANGRPKPTYKWL    281 - 350
KNGEPLLTRDRIQIEQGTLNITIVNLSDAGMYQCLAENKHGVIFSNAELSVIAVGPDFSRTLLKRVTLVK    351 - 420
VGGEVVIECKPKASPKPVYTWKKGRDILKENERITISEDGNLRIINVTKSDAGSYTCIATNHFGTASSTG    421 - 490
NLVVKDPTRVMVPPSSMDVTVGESIVLPCQVTHDHSLDIVFTWSFNGHLIDFDRDGDHFERVGGQDSAGD    491 - 560
LMIRNIQLKHAGKYVCMVQTSVDRLSAAADLIVRGPPGPPEAVTIDEITDTTAQLSWRPGPDNHSPITMY    561 - 630
VIQARTPFSVGWQAVSTVPELIDGKTFTATVVGLNPWVEYEFRTVAANVIGIGEPSRPSEKRRTEEALPE    631 - 700
VTPANVSGGGGSKSELVITWETVPEELQNGRGFGYVVAFRPYGKMIWMLTVLASADASRYVFRNESVHPF    701 - 770
SPFEVKVGVFNNKGEGPFSPTTVVYSAEEEPTKPPASIFARSLSATDIEVFWASPLEKNRGRIQGYEVKY    771 - 840
WRHEDKEENARKIRTVGNQTSTKITNLKGSVLYHLAVKAYNSAGTGPSSATVNVTTRKPPPSQPPGNIIW    841 - 910
NSSDSKIILNWDQVKALDNESEVKGYKVLYRWNRQSSTSVIETNKTSVELSLPFDEDYIIEIKPFSDGGD    911 - 980
GSSSEQIRIPKISNAYARGSGASTSNACTLSAISTIMISLTARSSL                            981 - 1026
//

Text Mined References (49)

PMID Year Title
27039371 2016 GWAS and transcriptional analysis prioritize ITPR1 and CNTN4 for a serum uric acid 3p26 QTL in Mexican Americans.
26146898 2015 Combined Whole Methylome and Genomewide Association Study Implicates CNTN4 in Alcohol Use.
25959733 2015 Contactin-4 mediates axon-target specificity and functional development of the accessory optic system.
25189868 2015 Gene-smoking interactions identify several novel blood pressure loci in the Framingham Heart Study.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24764060 2014 Gene-rich large deletions are overrepresented in POAG patients of Indian and Caucasian origins.
24556642 2014 Genome-wide association study of primary dentition pit-and-fissure and smooth surface caries.
24379826 2013 Genome-wide association analysis confirms and extends the association of SLC2A9 with serum uric acid levels to Mexican Americans.
23471985 2013 Genome-wide scan of healthy human connectome discovers SPON1 gene variant influencing dementia severity.
22750301 2012 Disruption of Contactin 4 in two subjects with autism in Chinese population.
More...