Property Summary

NCBI Gene PubMed Count 13
Grant Count 76
R01 Count 52
Funding $7,628,988.58
PubMed Score 1122.08
PubTator Score 44.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.874 0.000
chronic lymphosyte leukemia 1.100 0.000
periodontitis 1.700 0.000
interstitial cystitis 3.000 0.000
primary Sjogren syndrome 1.300 0.005
ulcerative colitis 1.800 0.001
ovarian cancer -1.500 0.000

Synonym

Accession Q8IWV1 B7Z744 J3KP69 Q6NSZ6 Q9NXB4
Symbols LAX

Gene

PANTHER Protein Class (2)

Gene RIF (6)

PMID Text
24515439 TRIM required LAX for binding to Rab8 in a complex, a novel CTLA-4/TRIM/LAX/Rab8 effector complex in the transport of CTLA-4 to the surfaces of T cells
22662118 We identified the transmembrane domain of LAX as a first motif targeting transmembrane protein constructs to detergent-resistant heavy rafts, a novel type of membrane microdomains containing a number of physiologically important proteins.
19536175 Observational study of gene-disease association. (HuGE Navigator)
18981125 inhibition of signaling events involved in T cell activation by LAX occurs through mechanisms both dependent on and independent of its tyrosine phosphorylation.
12359715 functions to negatively regulate signaling in lymphocytes
12359715 Overexpression of LAX in Jurkat cells specifically inhibits T cell receptor-mediated p38 MAPK activation and NFAT/AP-1 transcriptional activation.

AA Sequence

MDGVTPTLSTIRGRTLESSTLHVTPRSLDRNKDQITNIFSGFAGLLAILLVVAVFCILWNWNKRKKRQVP      1 - 70
YLRVTVMPLLTLPQTRQRAKNIYDILPWRQEDLGRHESRSMRIFSTESLLSRNSESPEHVPSQAGNAFQE     71 - 140
HTAHIHATEYAVGIYDNAMVPQMCGNLTPSAHCINVRASRDCASISSEDSHDYVNVPTAEEIAETLASTK    141 - 210
SPSRNLFVLPSTQKLEFTEERDEGCGDAGDCTSLYSPGAEDSDSLSNGEGSSQISNDYVNMTGLDLSAIQ    211 - 280
ERQLWVAFQCCRDYENVPAADPSGSQQQAEKDVPSSNIGHVEDKTDDPGTHVQCVKRTFLASGDYADFQP    281 - 350
FTQSEDSQMKHREEMSNEDSSDYENVLTAKLGGRDSEQGPGTQLLPDE                          351 - 398
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24515439 2014 Rab8 binding to immune cell-specific adaptor LAX facilitates formation of trans-Golgi network-proximal CTLA-4 vesicles for surface expression.
22662118 2012 The transmembrane region is responsible for targeting of adaptor protein LAX into "heavy rafts".
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
18981125 2008 Negative regulation of TCR signaling by linker for activation of X cells via phosphotyrosine-dependent and -independent mechanisms.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15843560 2005 Negative regulation of lymphocyte activation by the adaptor protein LAX.
More...