Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1170.39
PubTator Score 44.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
chronic lymphosyte leukemia 1.100 9.7e-09
interstitial cystitis 2.700 7.9e-04
osteosarcoma -1.874 1.1e-05
ovarian cancer -1.500 1.8e-05
periodontitis 1.700 2.8e-25
primary Sjogren syndrome 1.300 5.2e-03
ulcerative colitis 1.800 5.8e-04

Gene RIF (7)

AA Sequence

MDGVTPTLSTIRGRTLESSTLHVTPRSLDRNKDQITNIFSGFAGLLAILLVVAVFCILWNWNKRKKRQVP      1 - 70
YLRVTVMPLLTLPQTRQRAKNIYDILPWRQEDLGRHESRSMRIFSTESLLSRNSESPEHVPSQAGNAFQE     71 - 140
HTAHIHATEYAVGIYDNAMVPQMCGNLTPSAHCINVRASRDCASISSEDSHDYVNVPTAEEIAETLASTK    141 - 210
SPSRNLFVLPSTQKLEFTEERDEGCGDAGDCTSLYSPGAEDSDSLSNGEGSSQISNDYVNMTGLDLSAIQ    211 - 280
ERQLWVAFQCCRDYENVPAADPSGSQQQAEKDVPSSNIGHVEDKTDDPGTHVQCVKRTFLASGDYADFQP    281 - 350
FTQSEDSQMKHREEMSNEDSSDYENVLTAKLGGRDSEQGPGTQLLPDE                          351 - 398
//

Text Mined References (15)

PMID Year Title