Property Summary

NCBI Gene PubMed Count 99
PubMed Score 92.19
PubTator Score 86.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
astrocytic glioma 1.300 5.0e-02
Astrocytoma, Pilocytic 2.400 1.2e-08
Breast cancer 3.100 2.6e-02
breast carcinoma 1.200 1.3e-03
colon cancer 1.300 3.6e-02
cutaneous lupus erythematosus 2.000 4.8e-03
cystic fibrosis 2.674 8.8e-07
Duchenne muscular dystrophy 1.075 3.1e-08
ductal carcinoma in situ 1.400 3.8e-02
ependymoma 1.100 4.1e-02
gastric carcinoma 2.500 4.9e-02
glioblastoma 2.400 2.6e-02
interstitial cystitis 1.100 3.4e-02
invasive ductal carcinoma 3.174 7.7e-07
lung adenocarcinoma 1.100 4.3e-04
lung cancer 2.100 5.2e-04
malignant mesothelioma -5.000 7.3e-09
medulloblastoma, large-cell -1.400 1.2e-02
nasopharyngeal carcinoma 2.300 1.6e-04
non-small cell lung cancer 3.462 3.4e-25
osteosarcoma 2.513 1.8e-03
ovarian cancer -2.400 4.3e-06
pancreatic cancer 2.000 2.4e-04
pediatric high grade glioma 1.700 9.0e-03
primary pancreatic ductal adenocarcinoma 4.084 8.5e-06
primary Sjogren syndrome 1.400 1.9e-03
psoriasis -1.900 3.6e-04
X-linked cerebral adrenoleukodystrophy 1.600 4.6e-02

Gene RIF (46)

AA Sequence

MKYSCCALVLAVLGTELLGSLCSTVRSPRFRGRIQQERKNIRPNIILVLTDDQDVELGSLQVMNKTRKIM      1 - 70
EHGGATFINAFVTTPMCCPSRSSMLTGKYVHNHNVYTNNENCSSPSWQAMHEPRTFAVYLNNTGYRTAFF     71 - 140
GKYLNEYNGSYIPPGWREWLGLIKNSRFYNYTVCRNGIKEKHGFDYAKDYFTDLITNESINYFKMSKRMY    141 - 210
PHRPVMMVISHAAPHGPEDSAPQFSKLYPNASQHITPSYNYAPNMDKHWIMQYTGPMLPIHMEFTNILQR    211 - 280
KRLQTLMSVDDSVERLYNMLVETGELENTYIIYTADHGYHIGQFGLVKGKSMPYDFDIRVPFFIRGPSVE    281 - 350
PGSIVPQIVLNIDLAPTILDIAGLDTPPDVDGKSVLKLLDPEKPGNRFRTNKKAKIWRDTFLVERGKFLR    351 - 420
KKEESSKNIQQSNHLPKYERVKELCQQARYQTACEQPGQKWQCIEDTSGKLRIHKCKGPSDLLTVRQSTR    421 - 490
NLYARGFHDKDKECSCRESGYRASRSQRKSQRQFLRNQGTPKYKPRFVHTRQTRSLSVEFEGEIYDINLE    491 - 560
EEEELQVLQPRNIAKRHDEGHKGPRDLQASSGGNRGRMLADSSNAVGPPTTVRVTHKCFILPNDSIHCER    561 - 630
ELYQSARAWKDHKAYIDKEIEALQDKIKNLREVRGHLKRRKPEECSCSKQSYYNKEKGVKKQEKLKSHLH    631 - 700
PFKEAAQEVDSKLQLFKENNRRRKKERKEKRRQRKGEECSLPGLTCFTHDNNHWQTAPFWNLGSFCACTS    701 - 770
SNNNTYWCLRTVNETHNFLFCEFATGFLEYFDMNTDPYQLTNTVHTVERGILNQLHVQLMELRSCQGYKQ    771 - 840
CNPRPKNLDVGNKDGGSYDLHRGQLWDGWEG                                           841 - 871
//

Text Mined References (100)

PMID Year Title