Property Summary

NCBI Gene PubMed Count 96
Grant Count 45
R01 Count 4
Funding $1,803,387.15
PubMed Score 89.48
PubTator Score 86.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Gene RIF (43)

PMID Text
25477293 Results show that SULF1 or SULF2 overexpression contributes to colorectal cancer cell proliferation, migration, and invasion.
25469740 findings show an upregulation of SULF1 in degenerative discs for the first time, and suggest that there is a link between SULF1 and disc degeneration
24970807 Data suggest that Sulfatase 1 (hSulf-1) may be a suitable target for cancer therapy.
24911625 identification of markers including SULF1 may improve detection of this disease at its earliest stages improving patient treatment and prognosis
24726914 SULF1/SULF2 splice variants regulate pancreatic tumor progression.
24596063 Loss of HSulf-1 expression promotes tumorigenicity in ovarian cancer through regulating Bim expression.
24322345 rs6990375 polymorphism of SULF1 gene could be one of the factors related to recurrent miscarriage in Iranian women.
23950901 Knockdown of SULF2 in human corneal epithelial cell line slowed migration, which was restored by overexpression of either mouse SULF2 or human SULF1.
23891937 Strong interaction depends on the presence of Sulf1-substrate groups.
23684551 miR-21-mediated suppression of both hSulf-1 and PTEN led to activation of AKT/ERK pathways and epithelial-mesenchymal transition in hepatocellular carcinoma, promoting tumor growth.
More...

AA Sequence

MKYSCCALVLAVLGTELLGSLCSTVRSPRFRGRIQQERKNIRPNIILVLTDDQDVELGSLQVMNKTRKIM      1 - 70
EHGGATFINAFVTTPMCCPSRSSMLTGKYVHNHNVYTNNENCSSPSWQAMHEPRTFAVYLNNTGYRTAFF     71 - 140
GKYLNEYNGSYIPPGWREWLGLIKNSRFYNYTVCRNGIKEKHGFDYAKDYFTDLITNESINYFKMSKRMY    141 - 210
PHRPVMMVISHAAPHGPEDSAPQFSKLYPNASQHITPSYNYAPNMDKHWIMQYTGPMLPIHMEFTNILQR    211 - 280
KRLQTLMSVDDSVERLYNMLVETGELENTYIIYTADHGYHIGQFGLVKGKSMPYDFDIRVPFFIRGPSVE    281 - 350
PGSIVPQIVLNIDLAPTILDIAGLDTPPDVDGKSVLKLLDPEKPGNRFRTNKKAKIWRDTFLVERGKFLR    351 - 420
KKEESSKNIQQSNHLPKYERVKELCQQARYQTACEQPGQKWQCIEDTSGKLRIHKCKGPSDLLTVRQSTR    421 - 490
NLYARGFHDKDKECSCRESGYRASRSQRKSQRQFLRNQGTPKYKPRFVHTRQTRSLSVEFEGEIYDINLE    491 - 560
EEEELQVLQPRNIAKRHDEGHKGPRDLQASSGGNRGRMLADSSNAVGPPTTVRVTHKCFILPNDSIHCER    561 - 630
ELYQSARAWKDHKAYIDKEIEALQDKIKNLREVRGHLKRRKPEECSCSKQSYYNKEKGVKKQEKLKSHLH    631 - 700
PFKEAAQEVDSKLQLFKENNRRRKKERKEKRRQRKGEECSLPGLTCFTHDNNHWQTAPFWNLGSFCACTS    701 - 770
SNNNTYWCLRTVNETHNFLFCEFATGFLEYFDMNTDPYQLTNTVHTVERGILNQLHVQLMELRSCQGYKQ    771 - 840
CNPRPKNLDVGNKDGGSYDLHRGQLWDGWEG                                           841 - 871
//

Text Mined References (97)

PMID Year Title
26131010 2015 SULF 1 gene polymorphism, rs6990375 is in significant association with fetus failure in IVF technique.
25863062 2015 Catch bond interaction between cell-surface sulfatase Sulf1 and glycosaminoglycans.
25681501 2015 Sulf1 has ligand-dependent effects on canonical and non-canonical Wnt signalling.
25477293 2015 Enhanced tumorigenic potential of colorectal cancer cells by extracellular sulfatases.
25469740 2015 Increased sulfatase 1 gene expression in degenerative intervertebral disc cells.
25325968 2015 The Sulfs: expression, purification, and substrate specificity.
25105093 2014 The Role of Heparanase and Sulfatases in the Modification of Heparan Sulfate Proteoglycans within the Tumor Microenvironment and Opportunities for Novel Cancer Therapeutics.
24970807 2014 Sulfatase 1 (hSulf-1) reverses basic fibroblast growth factor-stimulated signaling and inhibits growth of hepatocellular carcinoma in animal model.
24911625 2014 Association of the SNP rs2623047 in the HSPG modification enzyme SULF1 with an Australian Caucasian breast cancer cohort.
24782989 2014 Transcriptional Activity of Heparan Sulfate Biosynthetic Machinery is Specifically Impaired in Benign Prostate Hyperplasia and Prostate Cancer.
More...