Property Summary

NCBI Gene PubMed Count 47
Grant Count 53
R01 Count 22
Funding $3,132,586.23
PubMed Score 62.91
PubTator Score 52.43

Knowledge Summary

Patent

No data available

Expression

Gene RIF (37)

PMID Text
26882224 Tumor expression of SULF2 may affect prognosis in NSCLC, while blood SULF2 levels may have a significant role in the diagnosis of this fatal disease.
26708018 Our data confirmed that Sulf2 promoted breast cancer progression and regulated the expression of tumor-related genes in breast cancer.
25887999 SULF2 have a pro-tumorigenic effect in DU-145 and PC3 cancer cells, suggesting an important role of this enzyme in prostatic cancer metastasis.
25477293 Results show that SULF1 or SULF2 overexpression contributes to colorectal cancer cell proliferation, migration, and invasion.
25444749 SULF2 blood levels increased with age in both healthy and cirrhosis patients.SULF2 blood level was higher in cirrhosis patients than healthy individuals.
25325976 SULF2 expression in human tumor tissue and cell lines, was assessed.
25164011 Our findings define Sulf-2 as a novel positive regulator of neuroblastoma pathogenicity that contributes to MYCN oncogenicity.
25127119 Substrate specificity of human SULF2.
25036960 pectin induced the expression of HSulf-2 through the interaction with fibronectin, alpha5beta1 integrin, and ERK1/2
24726914 SULF1/SULF2 splice variants regulate pancreatic tumor progression.
More...

AA Sequence

MGPPSLVLCLLSATVFSLLGGSSAFLSHHRLKGRFQRDRRNIRPNIILVLTDDQDVELGSMQVMNKTRRI      1 - 70
MEQGGAHFINAFVTTPMCCPSRSSILTGKYVHNHNTYTNNENCSSPSWQAQHESRTFAVYLNSTGYRTAF     71 - 140
FGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDSVSFFRTSKKM    141 - 210
YPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQ    211 - 280
RKRLQTLMSVDDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNV    281 - 350
EAGCLNPHIVLNIDLAPTILDIAGLDIPADMDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLL    351 - 420
HKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATGKLKLHKCKGPMRLGGSRALS    421 - 490
NLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPR    491 - 560
NLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLH    561 - 630
IDHEIETLQNKIKNLREVRGHLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLRE    631 - 700
QKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPFWTLGPFCACTSANNNTYWCMRTINETHNFL    701 - 770
FCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMDLGLKDGGSYE    771 - 840
QYRQFQRRKWPEMKRPSSKSLGQLWEGWEG                                            841 - 870
//

Text Mined References (50)

PMID Year Title
26882224 2016 SULF2 Expression Is a Potential Diagnostic and Prognostic Marker in Lung Cancer.
26708018 2016 Sulfatase 2 promotes breast cancer progression through regulating some tumor-related factors.
25887999 2015 SULF2 overexpression positively regulates tumorigenicity of human prostate cancer cells.
25477293 2015 Enhanced tumorigenic potential of colorectal cancer cells by extracellular sulfatases.
25444749 2015 SULF2, a heparan sulfate endosulfatase, is present in the blood of healthy individuals and increases in cirrhosis.
25325976 2015 Measuring sulfatase expression and invasion in glioblastoma.
25164011 2014 MYCN-dependent expression of sulfatase-2 regulates neuroblastoma cell survival.
25127119 2014 Oligosaccharide substrate preferences of human extracellular sulfatase Sulf2 using liquid chromatography-mass spectrometry based glycomics approaches.
25036960 2014 Pectin of Prunus domestica L. alters sulfated structure of cell-surface heparan sulfate in differentiated Caco-2 cells through stimulation of heparan sulfate 6-O-endosulfatase-2.
24726914 2014 SULF1/SULF2 splice variants differentially regulate pancreatic tumour growth progression.
More...