Property Summary

NCBI Gene PubMed Count 184
Grant Count 8
Funding $1,645,618.78
PubMed Score 153.61
PubTator Score 165.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... -2.500 0.034
breast carcinoma 1.400 0.000

Gene RIF (177)

PMID Text
26957571 Studies indicate that people who have particular mutations in a gene called SLC30A8 (Solute carrier family 30, member 8) are 65% less likely to get diabetes.
26824044 Detection of ZnT8 antibodies in blood precedes detection of classical islet antibodies in children at risk of developing diabetes mellitus type 1.
26214053 Association between SLC30A8 rs13266634 Polymorphism and Type 2 Diabetes Risk
25916116 genotypes of the polymorphic markers of KCNJ11, SLC30A8 and CDKN2B genes showed the presence of association with T2DM in Russian population, while for the FTO gene was not found statistically significant associations with type 2 diabetes
25501231 Data indicate that the SLC30A8 polymorphisms are associated with type 2 diabetes in the Saudi population but not for FTO, MC4R and KCNQ1 gene variants.
25348609 Zinc supplementation appears to affect the early insulin response to glucose differentially by rs13266634 genotype and could be beneficial for diabetes prevention and/or treatment for some individuals based on SLC30A8 variation.
25287711 Size and the direction of the effect of SLC30A8 risk alleles in man.
25178386 These data demonstrate that T1D patients may have single amino acid-specific autoantibodies directed against either ZnT8R or ZnT8W and that the autoantibody affinity to the respective variant may be different.
24830306 zinc transporter 8 and MAP3865c homologous epitopes are recognized by Hashimoto's thyroiditis subjects from Sardinia
24584071 SLC30A8 haploinsufficiency protects against type 2 diabetes, suggesting ZnT8 inhibition as a therapeutic strategy in type 2 diabetes prevention.
More...

AA Sequence

MEFLERTYLVNDKAAKMYAFTLESVELQQKPVNKDQCPRERPEELESGGMYHCHSGSKPTEKGANEYAYA      1 - 70
KWKLCSASAICFIFMIAEVVGGHIAGSLAVVTDAAHLLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAE     71 - 140
ILGALLSILCIWVVTGVLVYLACERLLYPDYQIQATVMIIVSSCAVAANIVLTVVLHQRCLGHNHKEVQA    141 - 210
NASVRAAFVHALGDLFQSISVLISALIIYFKPEYKIADPICTFIFSILVLASTITILKDFSILLMEGVPK    211 - 280
SLNYSGVKELILAVDGVLSVHSLHIWSLTMNQVILSAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQ    281 - 350
MESPVDQDPDCLFCEDPCD                                                       351 - 369
//

Text Mined References (188)

PMID Year Title
26957571 2016 Genetic mutations you want.
26824044 2016 Recognition of ZnT8, Proinsulin, and Homologous MAP Peptides in Sardinian Children at Risk of T1D Precedes Detection of Classical Islet Antibodies.
26214053 2015 Association between SLC30A8 rs13266634 Polymorphism and Type 2 Diabetes Risk: A Meta-Analysis.
25916116 [Association of the polymorphisms of the FTO, KCNJ11, SLC30A8 and CDKN2B genes with type 2 diabetes].
25501231 2014 Association between FTO, MC4R, SLC30A8, and KCNQ1 gene variants and type 2 diabetes in Saudi population.
25416956 2014 A proteome-scale map of the human interactome network.
25348609 2015 Effect of zinc supplementation on insulin secretion: interaction between zinc and SLC30A8 genotype in Old Order Amish.
25287711 2015 SLC30A8 mutations in type 2 diabetes.
25187374 2015 Genome-wide association meta-analysis identifies novel variants associated with fasting plasma glucose in East Asians.
25178386 2015 Zinc transporter 8 (ZnT8) autoantibody epitope specificity and affinity examined with recombinant ZnT8 variant proteins in specific ZnT8R and ZnT8W autoantibody-positive type 1 diabetes patients.
More...