Property Summary

NCBI Gene PubMed Count 35
Grant Count 5
R01 Count 4
Funding $768,060
PubMed Score 32.08
PubTator Score 26.93

Knowledge Summary

Patent (2,937)

Expression

Synonym

Accession Q8IWU2 A4D272 Q75MG7 Q9UPS3
Symbols BREK
KPI2
LMR2
cprk
KPI-2
hBREK
AATYK2
PPP1R100

Gene

Gene RIF (27)

PMID Text
26559041 Mutation of the di-acidic export motif led to endoplasmic reticulum retention of LMTK2, and an increase in protein half-life.
26008968 Lemur Tyrosine Kinase-2 (LMTK2), negatively regulates androgen-dependent and androgen-independent prostate cancer cell proliferation. In addition, LMTK2 also negatively regulates the androgen receptor transcriptional activity.
24727471 Data indicate that Lemur tyrosine kinase 2 (LMTK2) localizes at the plasma membrane and co-immunoprecipitates with cystic fibrosis transmembrane conductance regulator (CFTR) in airway epithelial cells.
23114966 The results indicate that lemur tyrosine kinase 2 is an integral membrane protein in which both the amino and carboxyl termini are exposed to the cytoplasm. Moreover, this topology places the kinase active site within the cytoplasm.
22220831 We describe a new signalling pathway within the nervous system that links cdk5/p35 with phosphatase-1C and which has implications for a number of neuronal functions and neuronal dysfunction
21071540 Observational study of gene-disease association. (HuGE Navigator)
20878950 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20569440 Low LMTK2 expression is associated with the development of prostate cancer.
20564319 Meta-analysis of gene-disease association. (HuGE Navigator)
20460480 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MPGPPALRRRLLLLLLVLLIAGSAGAAPLPQTGAGEAPPAAEVSSSFVILCVCSLIILIVLIANCVSCCK      1 - 70
DPEIDFKEFEDNFDDEIDFTPPAEDTPSVQSPAEVFTLSVPNISLPAPSQFQPSVEGLKSQVARHSLNYI     71 - 140
QEIGNGWFGKVLLGEIYTGTSVARVIVKELKASANPKEQDTFLKNGEPYYILQHPNILQCVGQCVEAIPY    141 - 210
LLVFEFCDLGDLKAYLRSEQEHMRGDSQTMLLQRMACEVAAGLAAMHKLHFLHSDLALRNCFLTSDLNVK    211 - 280
VGDYGIGFSRYKEDYIETDDKKVFPLRWTAPELVTSFQDRLLTADQTKYSNIWSLGVTLWELFDNAAQPY    281 - 350
SNLSNLDVLNQVIRERDTKLPKPQLEQPYSDRWYEVLQFCWLSPEKRPAAEDVHRLLTYLRLQSQRDSEV    351 - 420
DFEQQWNALKPNTNSRDSSNNAAFPILDHFARDRLGREMEEVLTVTETSQGLSFEYVWEAAKHDHFDERS    421 - 490
RGHLDEGLSYTSIFYPVEVFESSLSDPGPGKQDDSGQDVPLRVPGVVPVFDAHNLSVGSDYYIQLEEKSG    491 - 560
SNLELDYPPALLTTDMDNPERTGPELSQLTALRSVELEESSTDEDFFQSSTDPKDSSLPGDLHVTSGPES    561 - 630
PFNNIFNDVDKSEDLPSHQKIFDLMELNGVQADFKPATLSSSLDNPKESVITGHFEKEKPRKIFDSEPLC    631 - 700
LSDNLMHQDNFDPLNVQELSENFLFLQEKNLLKGSLSSKEHINDLQTELKNAGFTEAMLETSCRNSLDTE    701 - 770
LQFAENKPGLSLLQENVSTKGDDTDVMLTGDTLSTSLQSSPEVQVPPTSFETEETPRRVPPDSLPTQGET    771 - 840
QPTCLDVIVPEDCLHQDISPDAVTVPVEILSTDARTHSLDNRSQDSPGESEETLRLTESDSVLADDILAS    841 - 910
RVSVGSSLPELGQELHNKPFSEDHHSHRRLEKNLEAVETLNQLNSKDAAKEAGLVSALSSDSTSQDSLLE    911 - 980
DSLSAPFPASEPSLETPDSLESVDVHEALLDSLGSHTPQKLVPPDKPADSGYETENLESPEWTLHPAPEG    981 - 1050
TADSEPATTGDGGHSGLPPNPVIVISDAGDGHRGTEVTPETFTAGSQGSYRDSAYFSDNDSEPEKRSEEV   1051 - 1120
PGTSPSALVLVQEQPLPEPVLPEQSPAAQDSCLEARKSQPDESCLSALHNSSDLELRATPEPAQTGVPQQ   1121 - 1190
VHPTEDEASSPWSVLNAELSSGDDFETQDDRPCTLASTGTNTNELLAYTNSALDKSLSSHSEGPKLKEPD   1191 - 1260
IEGKYLGKLGVSGMLDLSEDGMDADEEDENSDDSDEDLRAFNLHSLSSESEDETEHPVPIILSNEDGRHL   1261 - 1330
RSLLKPTAANAPDPLPEDWKKEKKAVTFFDDVTVYLFDQETPTKELGPCGGEACGPDLSGPAPASGSPYL   1331 - 1400
SRCINSESSTDEEGGGFEWDDDFSPDPFMSKTTSNLLSSKPSLQTSKYFSPPPPARSTEQSWPHSAPYSR   1401 - 1470
FSISPANIASFSLTHLTDSDIEQGGSSEDGEKD                                        1471 - 1503
//

Text Mined References (39)

PMID Year Title
26559041 2015 Signal dependent ER export of lemur tyrosine kinase 2.
26008968 2015 Lemur Tyrosine Kinase 2, a novel target in prostate cancer therapy.
24727471 2014 LMTK2-mediated phosphorylation regulates CFTR endocytosis in human airway epithelial cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23114966 2013 Determination of the membrane topology of lemur tyrosine kinase 2 (LMTK2) by fluorescence protease protection.
22220831 2012 Cdk5/p35 phosphorylates lemur tyrosine kinase-2 to regulate protein phosphatase-1C phosphorylation and activity.
21071540 2011 Validation of genome-wide prostate cancer associations in men of African descent.
20878950 2011 Inherited genetic markers discovered to date are able to identify a significant number of men at considerably elevated risk for prostate cancer.
20569440 2010 Alterations in LMTK2, MSMB and HNF1B gene expression are associated with the development of prostate cancer.
More...