Property Summary

NCBI Gene PubMed Count 17
Grant Count 9
R01 Count 5
Funding $658,192.96
PubMed Score 30.00
PubTator Score 24.87

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
24790029 Genomic disruption of LRRC8A ablated volume-regulated anion channel (VRAC) currents. Cells with disruption of all five LRRC8 genes required LRRC8A cotransfection with other LRRC8 isoforms to reconstitute VRAC currents.
24725410 Study identified SWELL1 (LRRC8A), a member of a four-transmembrane protein family with unknown function, as essential for hypotonicity-induced iodide influx. SWELL1 is localized to the plasma membrane, and its knockdown dramatically reduces endogenous volume-regulated anion channel currents and regulatory cell volume decrease in various cell types.
15094057 identified four genes, named TA-LRRP, AD158, LRRC5, and FLJ23420, as unknown LRRC8-like genes
14660746 LRRC8 is required for B cell development.
10718198 Includes the cloning of this gene, designated as KIAA1437.

AA Sequence

MIPVTELRYFADTQPAYRILKPWWDVFTDYISIVMLMIAVFGGTLQVTQDKMICLPCKWVTKDSCNDSFR      1 - 70
GWAAPGPEPTYPNSTILPTPDTGPTGIKYDLDRHQYNYVDAVCYENRLHWFAKYFPYLVLLHTLIFLACS     71 - 140
NFWFKFPRTSSKLEHFVSILLKCFDSPWTTRALSETVVEESDPKPAFSKMNGSMDKKSSTVSEDVEATVP    141 - 210
MLQRTKSRIEQGIVDRSETGVLDKKEGEQAKALFEKVKKFRTHVEEGDIVYRLYMRQTIIKVIKFILIIC    211 - 280
YTVYYVHNIKFDVDCTVDIESLTGYRTYRCAHPLATLFKILASFYISLVIFYGLICMYTLWWMLRRSLKK    281 - 350
YSFESIREESSYSDIPDVKNDFAFMLHLIDQYDPLYSKRFAVFLSEVSENKLRQLNLNNEWTLDKLRQRL    351 - 420
TKNAQDKLELHLFMLSGIPDTVFDLVELEVLKLELIPDVTIPPSIAQLTGLKELWLYHTAAKIEAPALAF    421 - 490
LRENLRALHIKFTDIKEIPLWIYSLKTLEELHLTGNLSAENNRYIVIDGLRELKRLKVLRLKSNLSKLPQ    491 - 560
VVTDVGVHLQKLSINNEGTKLIVLNSLKKMANLTELELIRCDLERIPHSIFSLHNLQEIDLKDNNLKTIE    561 - 630
EIISFQHLHRLTCLKLWYNHIAYIPIQIGNLTNLERLYLNRNKIEKIPTQLFYCRKLRYLDLSHNNLTFL    631 - 700
PADIGLLQNLQNLAITANRIETLPPELFQCRKLRALHLGNNVLQSLPSRVGELTNLTQIELRGNRLECLP    701 - 770
VELGECPLLKRSGLVVEEDLFNTLPPEVKERLWRADKEQA                                  771 - 810
//

Text Mined References (23)

PMID Year Title
26824658 2016 LRRC8 Proteins Form Volume-Regulated Anion Channels that Sense Ionic Strength.
26530471 2015 Subunit composition of VRAC channels determines substrate specificity and cellular resistance to Pt-based anti-cancer drugs.
24790029 2014 Identification of LRRC8 heteromers as an essential component of the volume-regulated anion channel VRAC.
24782309 2014 The protein synthesis inhibitor blasticidin s enters mammalian cells via leucine-rich repeat-containing protein 8D.
24725410 2014 SWELL1, a plasma membrane protein, is an essential component of volume-regulated anion channel.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22532330 2012 LRRC8 proteins share a common ancestor with pannexins, and may form hexameric channels involved in cell-cell communication.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19946888 2010 Defining the membrane proteome of NK cells.
More...