Property Summary

NCBI Gene PubMed Count 20
Grant Count 14
R01 Count 13
Funding $1,469,062.07
PubMed Score 13.03
PubTator Score 10.93

Knowledge Summary

Patent (666)

Expression

Gene RIF (16)

PMID Text
26182346 Human Nav1.6 channels generate larger resurgent currents than human Nav1.1 channels, but the SCN4B-derived Navbeta4 peptide does not protect either isoform from use-dependent reduction.
26179811 Contribution of Cardiac Sodium Channel beta-Subunit Variants to Brugada Syndrome.
25757662 In a nonreferred nationwide Danish cohort of SIDS cases, up to 5/66 (7.5%) of SIDS cases can be explained by genetic variants in the sodium channel complex genes.
25450227 The expression of a human-specific isoform of the voltage-gated sodium channel subunit SCN4B was significantly correlated to lifetime alcohol consumption
24297919 results suggest the presence of a docking site that is maintained by a cysteine bridge buried within the hydrophobic core of beta4.
23604097 this is the first study to demonstrate an association of SCN4B mutations with AF, suggesting SCN4B as a novel AF susceptibility gene.
22842345 SCN5A-SCN4B were found to be essential for positive selection of CD4(+) T cells.
21115638 The paroxysmal extreme pain disorder associated Nav1.7 missense mutations M1627K, T1464I and V1299F increase Navbeta4 peptide-mediated resurgent sodium currents, in contrast to the erythromelalgia associated I848T and L858H Nav1.7 missense mutations.
21051419 Observational study of gene-disease association. (HuGE Navigator)
20226894 The researchers found evidence of an association between SCN4B subunit mutations and sudden infant death syndrome pathogenesis.
More...

AA Sequence

MPGAGDGGKAPARWLGTGLLGLFLLPVTLSLEVSVGKATDIYAVNGTEILLPCTFSSCFGFEDLHFRWTY      1 - 70
NSSDAFKILIEGTVKNEKSDPKVTLKDDDRITLVGSTKEKMNNISIVLRDLEFSDTGKYTCHVKNPKENN     71 - 140
LQHHATIFLQVVDRLEEVDNTVTLIILAVVGGVIGLLILILLIKKLIIFILKKTREKKKECLVSSSGNDN    141 - 210
TENGLPGSKAEEKPPSKV                                                        211 - 228
//

Text Mined References (20)

PMID Year Title
26182346 2015 Human Nav1.6 Channels Generate Larger Resurgent Currents than Human Nav1.1 Channels, but the Nav?4 Peptide Does Not Protect Either Isoform from Use-Dependent Reduction.
26179811 2015 Contribution of Cardiac Sodium Channel ?-Subunit Variants to Brugada Syndrome.
25757662 2015 The role of the sodium current complex in a nonreferred nationwide cohort of sudden infant death syndrome.
25450227 2015 Transcriptome organization for chronic alcohol abuse in human brain.
24297919 2013 Crystallographic insights into sodium-channel modulation by the ?4 subunit.
23604097 2013 Mutations of the SCN4B-encoded sodium channel ?4 subunit in familial atrial fibrillation.
22842345 2012 A voltage-gated sodium channel is essential for the positive selection of CD4(+) T cells.
21115638 2011 Nav1.7 mutations associated with paroxysmal extreme pain disorder, but not erythromelalgia, enhance Navbeta4 peptide-mediated resurgent sodium currents.
21051419 2011 Mutations in sodium channel ?-subunit SCN3B are associated with early-onset lone atrial fibrillation.
20226894 2010 Sudden infant death syndrome-associated mutations in the sodium channel beta subunits.
More...