Property Summary

NCBI Gene PubMed Count 21
PubMed Score 24.14
PubTator Score 10.93

Knowledge Summary

Patent (666)

TINX Plot

  Disease (6)

Expression

  Differential Expression (21)

Disease log2 FC p
adrenocortical carcinoma -1.796 7.8e-08
adult high grade glioma -2.100 2.5e-04
Astrocytoma, Pilocytic -1.600 1.3e-04
atypical teratoid / rhabdoid tumor -3.600 6.6e-09
Breast cancer -2.600 4.3e-42
breast carcinoma -2.000 7.8e-06
ductal carcinoma in situ -2.100 3.2e-05
ependymoma -1.600 3.0e-02
glioblastoma -1.900 3.6e-04
group 3 medulloblastoma -2.500 8.7e-05
interstitial cystitis -1.600 1.1e-02
intraductal papillary-mucinous adenoma (... -1.400 4.5e-04
intraductal papillary-mucinous carcinoma... -1.400 3.2e-04
intraductal papillary-mucinous neoplasm ... -1.300 6.7e-03
invasive ductal carcinoma -1.173 1.3e-02
lung adenocarcinoma -2.700 5.6e-16
medulloblastoma, large-cell -4.600 2.4e-08
non-small cell lung cancer -2.115 4.1e-17
oligodendroglioma -1.600 4.1e-02
Pick disease -1.100 4.1e-02
primitive neuroectodermal tumor -3.000 2.3e-05

Gene RIF (17)

AA Sequence

MPGAGDGGKAPARWLGTGLLGLFLLPVTLSLEVSVGKATDIYAVNGTEILLPCTFSSCFGFEDLHFRWTY      1 - 70
NSSDAFKILIEGTVKNEKSDPKVTLKDDDRITLVGSTKEKMNNISIVLRDLEFSDTGKYTCHVKNPKENN     71 - 140
LQHHATIFLQVVDRLEEVDNTVTLIILAVVGGVIGLLILILLIKKLIIFILKKTREKKKECLVSSSGNDN    141 - 210
TENGLPGSKAEEKPPSKV                                                        211 - 228
//

Text Mined References (21)

PMID Year Title