Property Summary

NCBI Gene PubMed Count 36
PubMed Score 64.15
PubTator Score 69.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
breast carcinoma 1.500 1.3e-03
juvenile dermatomyositis 1.020 5.1e-12
osteosarcoma 1.203 5.0e-04
sonic hedgehog group medulloblastoma 1.100 1.9e-03

Gene RIF (26)

AA Sequence

MSSSVEQKKGPTRQRKCGFCKSNRDKECGQLLISENQKVAAHHKCMLFSSALVSSHSDNESLGGFSIEDV      1 - 70
QKEIKRGTKLMCSLCHCPGATIGCDVKTCHRTYHYHCALHDKAQIREKPSQGIYMVYCRKHKKTAHNSEA     71 - 140
DLEESFNEHELEPSSPKSKKKSRKGRPRKTNFKGLSEDTRSTSSHGTDEMESSSYRDRSPHRSSPSDTRP    141 - 210
KCGFCHVGEEENEARGKLHIFNAKKAAAHYKCMLFSSGTVQLTTTSRAEFGDFDIKTVLQEIKRGKRMKC    211 - 280
TLCSQPGATIGCEIKACVKTYHYHCGVQDKAKYIENMSRGIYKLYCKNHSGNDERDEEDEERESKSRGKV    281 - 350
EIDQQQLTQQQLNGN                                                           351 - 365
//

Text Mined References (51)

PMID Year Title