Property Summary

NCBI Gene PubMed Count 26
Grant Count 10
R01 Count 5
Funding $383,750.61
PubMed Score 80.08
PubTator Score 61.12

Knowledge Summary

Patent (3,600)

Expression

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (12)

PMID Text
24047693 SAD-A and AMPK kinases are regulators of mTORC1 signaling in the pancreatic beta-cells.
23907667 BRSK2 interacted with VCP/p97 via three of the four functional domains of VCP/p97. Immunofluorescence demonstrated that BRSK2 and VCP/p97 were co-localized and also that knockdown of endogenous BRSK2 induced increased levels of CD3delta.
23029325 Anaphase-promoting complex/cyclosome-Cdh1, rather than Cdc20, promotes the degradation of BRSK2 in vivo.
22798068 a novel function of BRSK2 in the regulation of GSIS in beta-cells via a PCTAIRE1-dependent mechanism and suggest that BRSK2 is an attractive target for developing novel diabetic drugs.
22713462 these findings demonstrate ER stress may reduce BRSK2 protein and change BRSK2 subcellular localization, which in turn alleviate ER stress-induced apoptosis.
22609399 these findings provide a novel regulatory mechanism of BRSK2 through direct interaction with Jab1.
20646422 BRSK2 is up-regulated in pancreatic ductal adenocarcinoma.
18854318 STRADalpha.MO25alpha complexes containing LKB1 variants were equally effective at phosphorylating and activating AMPK, BRSK1, and BRSK2
18794342 level of SAD within neurons is modulated by TORC1
18339622 protein phosphatase 2C is a likely candidate for catalyzing the dephosphorylation and inactivation of BRSK1/2.
More...

AA Sequence

MTSTGKDGGAQHAQYVGPYRLEKTLGKGQTGLVKLGVHCVTCQKVAIKIVNREKLSESVLMKVEREIAIL      1 - 70
KLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEARKFFRQIISALDFCHSHSICHR     71 - 140
DLKPENLLLDEKNNIRIADFGMASLQVGDSLLETSCGSPHYACPEVIRGEKYDGRKADVWSCGVILFALL    141 - 210
VGALPFDDDNLRQLLEKVKRGVFHMPHFIPPDCQSLLRGMIEVDAARRLTLEHIQKHIWYIGGKNEPEPE    211 - 280
QPIPRKVQIRSLPSLEDIDPDVLDSMHSLGCFRDRNKLLQDLLSEEENQEKMIYFLLLDRKERYPSQEDE    281 - 350
DLPPRNEIDPPRKRVDSPMLNRHGKRRPERKSMEVLSVTDGGSPVPARRAIEMAQHGQRSRSISGASSGL    351 - 420
STSPLSSPRVTPHPSPRGSPLPTPKGTPVHTPKESPAGTPNPTPPSSPSVGGVPWRARLNSIKNSFLGSP    421 - 490
RFHRRKLQVPTPEEMSNLTPESSPELAKKSWFGNFISLEKEEQIFVVIKDKPLSSIKADIVHAFLSIPSL    491 - 560
SHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGEAQKENGIYSVTFTLLSGPSRRFKRVVETIQ    561 - 630
AQLLSTHDPPAAQHLSDTTNCMEMMTGRLSKCGSPLSNFFDVIKQLFSDEKNGQAAQAPSTPAKRSAHGP    631 - 700
LGDSAAAGPGPGGDAEYPTGKDTAKMGPPTARREQP                                      701 - 736
//

Text Mined References (32)

PMID Year Title
24429156 2013 Genetic variants associated with idiopathic pulmonary fibrosis susceptibility and mortality: a genome-wide association study.
24047693 2013 SAD-A and AMPK kinases: the "yin and yang" regulators of mTORC1 signaling in pancreatic ? cells.
23907667 2013 BRSK2 is a valosin-containing protein (VCP)-interacting protein that affects VCP functioning in endoplasmic reticulum-associated degradation.
23029325 2012 APC/C(Cdh1) targets brain-specific kinase 2 (BRSK2) for degradation via the ubiquitin-proteasome pathway.
22798068 2012 Brain-selective kinase 2 (BRSK2) phosphorylation on PCTAIRE1 negatively regulates glucose-stimulated insulin secretion in pancreatic ?-cells.
22713462 2012 BRSK2 is regulated by ER stress in protein level and involved in ER stress-induced apoptosis.
22669945 2012 Synapses of amphids defective (SAD-A) kinase promotes glucose-stimulated insulin secretion through activation of p21-activated kinase (PAK1) in pancreatic ?-Cells.
22609399 2012 Jab1 interacts with brain-specific kinase 2 (BRSK2) and promotes its degradation in the ubiquitin-proteasome pathway.
21985311 2012 Phosphorylation of microtubule-associated protein tau by AMPK-related kinases.
20646422 2010 [Clinical implication of BRSK2 expression in pancreatic ductal adenocarcinoma].
More...